% Encoding: UTF-8
@COMMENT{BibTeX export based on data in FAU CRIS: https://cris.fau.de/}
@COMMENT{For any questions please write to cris-support@fau.de}
@article{faucris.117374664,
abstract = {Heat sterilization of peritoneal dialysis (PD) fluids leads to the formation of glucose degradation products (GDPs), which considerably impair long-term application of PD. Knowledge of the exact composition of GDPs present in a PD fluid is important to improve the biocompatibility of dialysis solutions. The present study conducted a targeted screening for novel GDPs with α-dicarbonyl structure in PD fluids. Thus, 3-deoxygalactosone (3-DGal) was identified for the first time in PD fluids. Quantification of 3-DGal was achieved by high-performance liquid chromatography (HPLC)/DAD/MSMS after derivatization with o-phenylendiamine to yield the quinoxaline derivative. Baseline separation of all α-dicarbonyl GDPs, particularly of the diastereomers 3-deoxyglucosone (3-DG) and 3-DGal, required the application of a polar, phenyl-based RP column for HPLC and additional pH-gradient elution. Concentrations of 3-DGal ranged between 55.8 and 136.9 μM in single-chamber PD fluids, and between 2.5 and 12.4 μM in double-chamber PD fluids. In solutions containing glucose, 3-DGal is formed from 3-DG via the intermediate 3,4-dideoxyglucosone-3-ene (3,4-DGE). Further studies are now required to determine the (patho-)physiological properties of 3-DGal. © 2010 Springer-Verlag.},
author = {Mittelmaier, Stefan and Fünfrocken, Michael and Fenn, Dominik and Pischetsrieder, Monika},
doi = {10.1007/s00216-010-4456-3},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {3-Deoxygalactosone (3-DGal); [alpha]-Dicarbonyl compounds; Glucose degradation products (GDPs); HPLC; Peritoneal dialysis fluid; Quinoxaline derivatives},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.3deoxy},
pages = {1689-1697},
peerreviewed = {Yes},
title = {3-{Deoxygalactosone}, a new glucose degradation product in peritoneal dialysis fluids: {Identification}, quantification by {HPLC}/{DAD}/{MSMS} and its pathway of formation},
volume = {399},
year = {2011}
}
@article{faucris.203401739,
abstract = {To evaluate if the recently identified antimicrobial milk peptides alpha(S2)-casein(182-207) and alpha(S2)-casein(151-181) can be of physiological or technological relevance, their presence in commercial milk was investigated. Thus, a UHPLC-ESI-MS/MS scheduled multiple reaction monitoring method was developed for quantification using stable isotope-labeled peptides. The developed protocol gave very good linear response (R-2 > 0.99) for both peptides, recovery > 95% and coefficients of variations of 5.51% and 4.79%. The limits of detection (0.3 nM alpha(S2)-casein(182-207) and 0.5 nM alpha(S2)-casein(151-181)) were low enough to detect both peptides without further enrichment. The highest peptide concentration was recorded in pasteurized milk (1.36 mu M alpha(S2)-casein(182-207) and 0.20 mu M alpha(S2)-casein(151-181)). The concentration of alpha(S2)-casein(182-207) was in a range that was previously reported to act bacteriostatic against Bacillus subtilis. Industrial milk processing led to a significant loss of both peptides resulting in a mean concentration of 0.47 mu M alpha(S2)-casein(182-207) and 0.098 mu M alpha(S2)-casein(151-181) in ultrahigh-temperature milk.},
author = {Liu, Yufang and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2018.04.004},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {alpha(S2)-casein(182-207);Antimicrobial peptides;Milk;UHPLC-ESI-MS/MS-sMRM;Absolute quantification},
pages = {15-20},
peerreviewed = {Yes},
title = {{Absolute} quantification of two antimicrobial peptides alpha({S2})-casein(182-207) and alpha({S2})-casein(151-181) in bovine milk by {UHPLC}-{ESI}-{MS}/{MS} in {sMRM} mode},
volume = {261},
year = {2018}
}
@article{faucris.235580092,
abstract = {Hordenine, a natural constituent of germinated barley, is a biased agonist of the dopamine D2 receptor. This pilot study investigated the biokinetics of hordenine and its metabolites in four volunteers consuming beer equal to 0.075 mg hordenine/kg body weight. A new ultrahigh-performance liquid chromatography method coupled to electrospray ionization tandem mass spectrometry (UHPLC-ESI-MS/MS) method determined maximum plasma concentrations of 12.0-17.3 nM free hordenine after 0-60 min. Hordenine phase-II metabolism was first dominated by sulfation, but later by glucuronidation. The elimination half-lives in plasma were 52.7-66.4 min for free hordenine and about 60/80 min longer for hordenine sulfate and hordenine glucuronide. Urinary excretion peaked 2-3.5 h after consumption and accumulated to 3.78 μmol within 24 h, corresponding to 9.9% of the ingested dose. The observed hordenine levels in plasma seem too low to provoke direct interaction with the dopamine D2 receptor related to food reward, but synergistic or additive effects with alcohol or N-methyltyramine may occur.},
author = {Sommer, Thomas and Göen, Thomas and Budnik, Nadja and Pischetsrieder, Monika},
doi = {10.1021/acs.jafc.9b06029},
faupublication = {yes},
journal = {Journal of agricultural and food chemistry},
keywords = {beer; biokinetics; dopamine D2 receptor; hordenine; human metabolism},
note = {CRIS-Team Scopus Importer:2020-03-10},
pages = {1998-2006},
peerreviewed = {Yes},
title = {{Absorption}, {Biokinetics}, and {Metabolism} of the {Dopamine} {D2} {Receptor} {Agonist} {Hordenine} ({N}, {N}-{Dimethyltyramine}) after {Beer} {Consumption} in {Humans}},
url = {https://pubs.acs.org/articlesonrequest/AOR-ihpHAjdIDEUyis7yZwim},
volume = {68},
year = {2020}
}
@article{faucris.230226175,
abstract = {Triacylglycerols represent the major part (>90 %) in most plant oils
and have to be eliminated, when the minor compounds such as phytosterols
or tocopherols should be analyzed. Here, we used an all liquid-liquid
chromatographic technique, countercurrent chromatography (CCC), to
fractionate the minor lipids before gas chromatography (GC) analysis. To
cover the wide range of polarity of the minor compounds, we used the
co-current mode, in which both mobile and stationary phase are pumped
through the system. This allowed to elute substances which partitioned
almost exclusively in the stationary phase within 90 min. After testing
with standard compounds, the method was applied to the separation of
sesame oil and sunflower oil samples. The abundant triacylglycerols
could be effectively separated from tocopherols, phytosterols,
diacylglycerols, and free fatty acids in the samples, and these
compounds could be analyzed (after trimethylsilylation) by GC coupled
with mass spectrometry. After the enrichment caused by the CCC
fractionation, we were also able to identify the tocopherol derivative
α-tocomonoenol, which had not been described in sunflower oil before.
Also, separation of sesame oil yielded a mixture of the polar compounds
sesamin and sesamolin without further impuritie},
author = {Hammann, Simon and Englert, Michael and Müller, Marco and Vetter, Walter},
doi = {10.1007/s00216-015-9068-5},
faupublication = {no},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {Sample preparation; Gas chromatography; Lipids; Countercurrent chromatography; Co-current},
pages = {9019-9028},
peerreviewed = {Yes},
title = {{Accelerated} separation of {GC}-amenable lipid classes in plant oils by countercurrent chromatography in the co-current mode},
url = {https://link.springer.com/article/10.1007/s00216-015-9068-5},
volume = {407},
year = {2015}
}
@incollection{faucris.110979044,
address = {Lübeck},
author = {Kislinger, Thomas and Schneider, Marc and Pischetsrieder, Monika},
booktitle = {Aging. Morphological, Biochemical, Molecular and Social Aspects},
editor = {Oehmichen, M. et al.},
faupublication = {yes},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.accumu},
pages = {235-248},
peerreviewed = {Yes},
publisher = {Schmidt-Röhmhild},
series = {Research in Legal Medicine},
title = {{Accumulation} of non-enzymatic glycation products on proteins and {DNA}},
volume = {27},
year = {2002}
}
@article{faucris.107695764,
abstract = {Beta-bitter acids of hops (lupulones) revealed sedative and antidepressant-like effects in animal studies. Transformation of beta-acids during beer brewing leads to the formation of tricyclic transformation products, which have a close structural analogy to hyperforin. The latter compound is responsible for the antidepressant activity of St. John's wort by activation of TRPC6 cation channels in neuronal-like cells leading to Ca2+ influx. In this study, nortricyclolupones, dehydrotricyclolupones, and tricyclolupones were isolated from a wort-boiling model and their structures were elucidated by UHPLC-DAD, UHPLC-ESI--MS/MS and 1D/2D-NMR spectroscopy. Beta-bitter acids and their transformation products induced Ca2+ influx in PC12 cells to the same extent as hyperforin. Application of a Ca2+-free environment abolished the Ca2+ elevation, indicating that the increase is mediated by influx across the plasma membrane. Thus, activation of neuronal-like Ca2+-channels by lupulones and tricyclolupones represent a novel mechanism contributing to the antidepressant activity of hops.},
author = {Schulz, Carolin and Fritz, Nikolas and Sommer, Thomas and Krofta, Karel and Friedland, Kristina and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2018.01.073},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Antidepressant;beta-bitter acids;Ca2+ influx;Hops;Lupulones;Neuronal-like cells;Tricyclolupones},
pages = {215-227},
peerreviewed = {Yes},
title = {{Activation} of membrane-located {Ca2}+ channels by hop beta acids and their tricyclic transformation products},
volume = {252},
year = {2018}
}
@article{faucris.115257384,
abstract = {In addition to direct antioxidative effects, Maillard reaction products (MRPs) could increase the antioxidative capacity of cells through the induction of cytoprotective enzymes. Since many of those enzymes are regulated by the transcription factor Nrf2, the effect of MRPs on nuclear translocation of Nrf2 in macrophages and Caco-2 cells was investigated. Stimulation of both cell types by MRPs showed a concentration-dependent significant increase in nuclear translocation of Nrf2 up to fivefold after short-term (2 h) and up to 50-fold after long-term treatment (24 h). In intact human gut tissue, nuclear translocation of Nrf2 was significantly twofold increased after short-term incubation. To study the activation mechanisms, macrophages and Caco-2 cells were stimulated with MRPs in the presence of catalase, which significantly suppressed Nrf2 activation. Thus, activation was related to extracellular H 2O2 continuously formed from MRPs. Short-term incubation with coffee, a MRP-rich beverage, led to a trend towards Nrf2 activation in macrophages, but not in Caco-2 cells or intact human gut tissue. Long-term incubation with coffee (1-4 mg/mL) significantly increased nuclear Nrf2 up to 17-fold. Since raw coffee was inactive under the tested conditions, the effect was related to roasting products. Coffee-induced Nrf2 translocation was, however, only slightly reversed by catalase. Therefore, the Nrf2 activity of coffee can only partially be explained by MRP-induced, H2O 2-dependent mechanisms. Thus, it can be concluded that MRPs may increase the antioxidative capacity inside the cell by inducing Nrf2-regulated signalling pathways not only in different cell types, but also in intact gut tissue. © 2012 Springer-Verlag.},
author = {Sauer, Tanja and Raithel, Martin and Kressel, Jürgen and Münch, Gerald and Pischetsrieder, Monika},
doi = {10.1007/s00726-012-1222-1},
faupublication = {yes},
journal = {Amino Acids},
keywords = {Coffee; Hydrogen peroxide; Intact human gut tissue; Maillard products; Nrf2; Roasting products},
note = {UnivIS-Import:2015-04-14:Pub.2013.nat.dchph.llmch.activa},
pages = {1427-1439},
peerreviewed = {Yes},
title = {{Activation} of the transcription factor {Nrf2} in macrophages, {Caco}-2 cells and intact human gut tissue by {Maillard} reaction products and coffee},
volume = {44},
year = {2013}
}
@article{faucris.117923784,
abstract = {Maillard reaction products (MRPs) have antioxidative properties in vitro but the influence of a diet rich in MRPs on oxidative damage in vivo remains unknown. In this study, the influence of thermally processed foods rich in MRPs on copper induced oxidation of human low-density lipoprotein (LDL) in vitro was examined. Moreover, oxidative resistance of LDL (OR) in blood plasma of eight healthy subjects was monitored, who consumed diets poor and rich in MRPs in
weekly turn for 3 weeks. Dark beer, bread crust, and roasted coffee led to a statisticaIly significant increased OR in vitro compared to pale beer, bread crumb, and raw coffee. The consumption of a diet rich in MRPS significantly increased plasma OR compared to the diet poor in MRPs by 35.5%. This study indicates that thermally processed foods rich in MRPs inhibit the LDL oxidation in vitro and have the ability to reduce oxidative modification of LDL in vivo.},
author = {Dittrich, Ralf and Dragonas, Charalampos and Kannenkeril, D. and Hoffmann, Inge and Müller, Andreas and Beckmann, Matthias and Pischetsrieder, Monika},
doi = {10.1016/j.foodres.2009.04.007},
faupublication = {yes},
journal = {Food Research International},
keywords = {Beer; Coffee; Diet; LDL oxidation; Maillard reaction products},
note = {UnivIS-Import:2015-04-14:Pub.2009.nat.dchph.llmch.adietr},
pages = {1315-1322},
peerreviewed = {Yes},
title = {{A} diet rich in {Mailllard} reaction products protects {LDL} against copper induced oxidation ex vivo, a human intervention trial},
volume = {42},
year = {2009}
}
@article{faucris.120091224,
author = {Lohwasser, Christina and Pischetsrieder, Monika and Schuppan, Detlef},
faupublication = {yes},
journal = {Hepatology},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.advanc},
pages = {431A},
peerreviewed = {Yes},
title = {{Advanced} glycation end products ({AGE}) and the cytokine {TNF}-alpha, {TGF}-beta and {IL}-6 stimulate the expression of the receptor of {AGE} ({RAGE}) in hepatic stellate cells},
volume = {36},
year = {2002}
}
@article{faucris.120168664,
author = {Dinarello, Charles A. and Reznikov, Leonid and Waksman, Javier and Pischetsrieder, Monika and Shaldon, Stanley},
faupublication = {yes},
journal = {Blood Purification},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.advanc},
pages = {347-349},
peerreviewed = {Yes},
title = {{Advanced} {Glycation} {End} {Products} {Augments} {Signaling} from {Toll}-like {Receptors}},
volume = {21},
year = {2003}
}
@article{faucris.121122584,
abstract = {Hyperglycaemia causes increased protein glycation and the formation of advanced glycation endproducts which underlie the complications of diabetes and ageing. Glycation is accompanied by metal-catalysed oxidation of glucose and Amadori products to form free radicals capable of protein fragmentation. Aged garlic extract is a potent antioxidant with established lipid-lowering effects attributed largely to a key ingredient called S-allyl cysteine. This study investigated the ability of aged garlic extract and S-allyl cysteine to inhibit advanced glycation in vitro. Bovine serum albumin (BSA) was glycated in the presence of Cu2+ ions and different concentrations of aged garlic extract and protein fragmentation was examined by sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE). Lysozyme was glycated by glucose or methylglyoxal in the presence of different concentrations of aged garlic extract or S-allyl cysteine with subsequent analysis of glycationderived crosslinking using SDS-PAGE. Amadori-rich protein was prepared by dialysing lysozyme that had been glycated by ribose for 24 h. This ribated lysozyme was reincubated and the effects of aged garlic extract, S-allyl cysteine and pyridoxamine on glycation-induced crosslinking was monitored. Aged garlic extract inhibited metal-catalysed protein fragmentation. Both aged garlic extract and S-allyl cysteine inhibited formation of glucose and methylglyoxal derived advanced glycation endproducts and showed potent Amadorin activity when compared to pyridoxamine. S-allyl cysteine inhibited formation of carboxymethyllysine (CML), a non-crosslinked advanced glycation endproduct derived from oxidative processes. Further studies are required to assess whether aged garlic extract and S-allyl cysteine can protect against the harmful effects of glycation and free radicals in diabetes and ageing.},
author = {Ahmad, Muhammad Saeed and Pischetsrieder, Monika and Ahmed, Nessar},
doi = {10.1016/j.ejphar.2007.01.041},
faupublication = {yes},
journal = {European Journal of Pharmacology},
keywords = {Glycation; Aged garlic extract; S-allyl cysteine; Diabetes; Antioxidant},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.agedga},
pages = {32-38},
peerreviewed = {Yes},
title = {{Aged} garlic extract and {S}-allyl cysteine prevent formation of advanced glycation end-products},
volume = {561},
year = {2007}
}
@article{faucris.263542897,
abstract = {Fluoride is a major oligo element found in nature, at excessive amounts can cause enormous harm in mammalian cells. Fruits peel, considered most often as a waste of juice processing, could play an important role in attenuating metal cytotoxicity. The present study evaluated the effect of pomegranate peel (Punica granatum. L) methanolic extract (PPE) on the Fluoride-induced toxicity and redox status in the protozoa Tetrahymena pyriformis. Polyphenols of peel extract were extracted using methanol and characterized by spectrophotometric methods, total phenolic content (TPC), total flavonoids content (TFC), and in vitro, antioxidant properties were assessed using the Folin-Ciocalteu method and DPPH, ABTS, and FRAP. Pomegranate peel is a rich source of phenolic compounds TP (223.21 +/- 15 mg GAE/g dw), TF (52.12 +/- 1.36 mg Qu/g dw) and showed high antioxidant properties DPPH (EC50 0.043 +/- 0.06 mg/ml), ABTS (EC50 0.06 +/- 0.01 mg/ml) and FRAP (1.47 +/- 0.01 mg AA equivalents/g dw). Cells were incubated with fluoride alone and in combination with PPE. NaF (0.8 mM) significantly decreased the cell viability, induced oxidative stress by decreasing antioxidants enzyme activities, and increased intracellular fluoride content. Treatment with NaF in combination with PPE decreases CAT, SOD, and GPx activities and alleviates GSH content. These findings suggest that pomegranate peel biomolecules may have a protective effect against fluoride induced-toxicity.},
author = {Sabraoui, Talal and Grina, Fatiha and Khider, Taleb and Nasser, Boubker and Eddoha, Rabiaa and Moujahid, Abderahman and Benbachir, Maryem and Essamadi, Abdelkhalid},
doi = {10.33263/BRIAC123.37103724},
faupublication = {yes},
journal = {Biointerface Research in Applied Chemistry},
note = {CRIS-Team WoS Importer:2021-09-03},
pages = {3710-3724},
peerreviewed = {unknown},
title = {{Alleviate} {Effect} of {Pomegranate} {Peel} {Extract} in {Ameliorating} {Fluoride}-{Induced} {Cytotoxicity}, {Oxidative} {Stress} in {Tetrahymena} pyriformis {Model}},
volume = {12},
year = {2022}
}
@article{faucris.285701509,
abstract = {Shear cell technology is a promising method for the production of meat analogues. Meat analogues are also studied as alternative proteins for dogs and cats, which require high-quality protein. This study monitored the effect of shearing, using shear cell technology, and sterilization (26 min at 125.5 degrees C) on selected amino acids, advanced glycation end products (AGEs), lysinoalanine, o-phthalaldehyde-reactive lysine, as well as oxidation markers, free thiols, and dityrosine, in soy protein- and pea protein-based meat analogues. These are compared with animal-based pet foods. Processing resulted in modified amino acids, especially cysteine. Reductions in amino acid levels were higher in the soy-based meat analogue, but markers indicated more pronounced oxidation in the pea-based meat analogue. AGEs and lysinoalanine were not formed on shearing, only during sterilization. Despite extensive thermal treatment, the effects of processing on the protein quality of plant-based products were comparable or less than those in animal-based pet food.},
author = {Zenker, Hannah and Wehrmaker, Ariane M. and Zenker, Hannah Elisabeth and De Groot, Wouter and Sanders, Mark and Van Der Goot, Atze Jan and Janssen, Anja E. M. and Keppler, Julia and Bosch, Guido},
doi = {10.1021/acsfoodscitech.2c00242},
faupublication = {yes},
journal = {ACS Food Science & Technology},
note = {CRIS-Team WoS Importer:2022-11-25},
peerreviewed = {Yes},
title = {{Amino} {Acid} {Modifications} {During} the {Production} ({Shearing}, {Sterilization}) of {Plant}-{Based} {Meat} {Analogues}: {An} {Explorative} {Study} {Using} {Pet} {Food} {Production} as an {Example}},
year = {2022}
}
@article{faucris.287203056,
abstract = {Polyphenol–protein reactions in model solutions of β-lactoglobulin (β-LG) incubated with (−)-epicatechin at 37 °C and 60 °C were monitored by microLC–timsTOF Pro-MS/MS combined with bioinformatics strategies. The addition of (−)-epicatechin to the model solutions resulted in changes in tryptic peptide profiles. Covalent bond formation between (−)-epicatechin o-quinones and β-LG was identified for the residues S27, S30, K60, C66, K69, and C160, with C160 being the predominant binding site. Furthermore, the incubation of β-LG with (−)-epicatechin significantly promoted oxidation, especially for the residues M7 and M24. The reaction of monomeric (−)-epicatechin o-quinone at C160 was also identified in the milk chocolate sample. The adaptation of this study by extending the scope of the reaction products offers significant potential for comprehensive food profiling strategies.},
author = {Börsig, Amelie and Konar, Nevzat and Dalabasmaz, Sevim},
doi = {10.1016/j.foodchem.2022.135242},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {(−)-Epicatechin; (−)-Epicatechin (PubChem CID: 72276); Methionine sulfoxide; Polyphenol–protein reactions; Proteomics; Site-specificity; β-Lactoglobulin},
note = {Created from Fastlane, Scopus look-up},
peerreviewed = {Yes},
title = {{A} model study on the site-specificity of (−)-epicatechin-induced reactions in β-lactoglobulin by high-resolution mass spectrometry in combination with bioinformatics},
volume = {408},
year = {2023}
}
@article{faucris.111853984,
abstract = {Advanced glycation end-products (AGEs) of DNA are formed spontaneously by the reaction of carbonyl compounds such as sugars, methylglyoxal or dihydroxyacetone in vitro and in vivo. Little is known, however, about the biological consequences of DNA AGEs. In this study, a method was developed to determine the parameters that promote DNA glycation in cultured cells. For this purpose, the formation rate of N2-carboxyethyl-2′- deoxyguanosine (CEdG), a major DNA AGE, was measured in cultured hepatic stellate cells by liquid chromatography (LC)-MS/MS. In resting cells, a 1.7-fold increase of CEdG formation rate was observed during 14 days of incubation. To obtain insights into the functional consequences of DNA glycation, CEdG was introduced into a luciferase reporter gene vector and transfected into human embryonic kidney (HEK 293 T) cells. Gene activity was determined by chemiluminescence of the luciferase. Thus, CEdG adducts led to a dose-dependent and highly significant decrease in protein activity, which is caused by loss of functionality of the luciferase in addition to reduced transcription of the gene. When the CEdG-modified vector was transformed into Escherichia coli, a loss of ampicillin resistance was observed in comparison to transformation with the unmodified plasmid. These results indicate that CEdG accumulates in the genomic DNA of resting cells, which could lead to diminished protein activity. © 2008 The Authors.},
author = {Breyer, Viola and Frischmann, Matthias and Bidmon, Clemens and Schemm, Annelen and Schiebel, Katrin and Pischetsrieder, Monika},
doi = {10.1111/j.1742-4658.2008.06255.x},
faupublication = {yes},
journal = {Febs Journal},
keywords = {Advanced glycation end-products; DNA; Eukaryotic cells; Maillard reaction; N},
note = {UnivIS-Import:2015-03-09:Pub.2008.nat.dchph.llmch.analys},
pages = {914-925},
peerreviewed = {Yes},
title = {{Analysis} and biological relevance of advanced glycation end-products of {DNA} in eukaryotic cells},
volume = {275},
year = {2008}
}
@article{faucris.224545416,
abstract = {Seeds represent the major source of food protein, impacting on both human nutrition and animal feeding. Therefore, seed quality needs to be appropriately addressed in the context of viability and food safety. Indeed, long-term and inappropriate storage of seeds might result in enhancement of protein glycation, which might affect their quality and longevity. Glycation of seed proteins can be probed by exhaustive acid hydrolysis and quantification of the glycation adduct Nepsilon-(carboxymethyl)lysine (CML) by liquid chromatography-mass spectrometry (LC-MS). This approach, however, does not allow analysis of thermally and chemically labile glycation adducts, like glyoxal-, methylglyoxal- and 3-deoxyglucosone-derived hydroimidazolones. Although enzymatic hydrolysis might be a good solution in this context, it requires aqueous conditions, which cannot ensure reconstitution of seed protein isolates. Because of this, the complete profiles of seed advanced glycation end products (AGEs) are not characterized so far. Therefore, here we propose the approach, giving access to quantitative solubilization of seed proteins in presence of sodium dodecyl sulfate (SDS) and their quantitative enzymatic hydrolysis prior to removal of SDS by reversed phase solid phase extraction (RP-SPE). Using methylglyoxal-derived hydroimidazolone 1 (MG-H1) as a case example, we demonstrate the applicability of this method for reliable and sensitive LC-MS-based quantification of chemically labile AGEs and its compatibility with bioassays.},
author = {Antonova, Kristina and Vikhnina, Maria and Soboleva, Alena and Mehmood, Tahir and Heymich, Marie-Louise and Leonova, Tatiana and Bankin, Mikhail and Lukasheva, Elena and Gensberger-Reigl, Sabrina and Medvedev, Sergej and Smolikova, Galina and Pischetsrieder, Monika and Frolov, Andrej},
doi = {10.3390/ijms20153659},
faupublication = {yes},
journal = {International Journal of Molecular Sciences},
keywords = {Advanced glycation end products (AGEs); enzymatic hydrolysis; glycation; methylglyoxal-derived hydroimidazolone 1 (MG-H1); seeds; seed ageing; seed quality; sodium dodecyl sulfate (SDS)},
peerreviewed = {Yes},
title = {{Analysis} of {Chemically} {Labile} {Glycation} {Adducts} in {Seed} {Proteins}: {Case} {Study} of {Methylglyoxal}-{Derived} {Hydroimidazolone} 1 ({MG}-{H1}).},
url = {https://www.mdpi.com/1422-0067/20/15/3659},
volume = {20},
year = {2019}
}
@article{faucris.285681229,
abstract = {Chlorate is a food contaminant that is mainly attributed to the use of chlorinated water and disinfectants. The present study investigated if chlorate could also occur as a process contaminant in chemical leavening agents for baking products. Thus, a sensitive and rapid ultrahigh-performance liquid chromatography-tandem mass spectrometry method was developed and validated. Chlorate was quantified using an isotopically labeled internal standard after complete degassing of carbonate-based products. The limit of detection/limit of quantification was 0.02 and 0.1 mg/kg, respectively, with recovery rates between 97.0 and 101.2% (concentration levels: 0.3, 1.4, or 5.0 mg/kg). Samples of baking powder, sodium bicarbonate, ammonium bicarbonate, and potassium carbonate were analyzed. Chlorate was detected in all samples of baking powder in concentrations of 0.23-1.87 mg/kg. Potassium carbonate contained the highest chlorate levels, with a maximum of 60.9 mg/kg. These results indicate that baking powder and, particularly, potassium carbonate can be relevant sources of chlorate in food. },
author = {Gensberger-Reigl, Sabrina and Rodrigues Guimarães Abreu, Vera Lúcia and Pischetsrieder, Monika},
doi = {10.1021/acs.jafc.2c04627},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {baking powder; chlor-alkali electrolysis; chlorate; potassium carbonate; sodium bicarbonate; UHPLC-MS/MS},
note = {CRIS-Team Scopus Importer:2022-11-25},
peerreviewed = {Yes},
title = {{Analysis} of {Chlorate} in {Chemical} {Leavening} {Agents} {Used} for {Bakery} {Products} by {Liquid} {Chromatography}-{Mass} {Spectrometry}},
year = {2022}
}
@article{faucris.116618744,
abstract = {Sugars and sugar degradation products readily react in vitro with guanine derivatives, resulting in the formation of DNA-bound advanced glycation end-products (DNA-AGEs). The two diastereomers of N2-(1-carboxyethyl)-2′-deoxyguanosine (CEdGA,B) and the cyclic adduct of methylglyoxal and 2′-deoxyguanosine (mdG) (N2-7-bis(1-hydroxy-2-oxopropyl)-2′-deoxyguanosine have also been detected in cultured cells and/or in vivo. LC-MS/MS methods have been developed to analyze sensitively DNA adducts in vitro and in vivo. In this paper, the chemical structures of possible DNA-AGEs and the application of LC-MS/MS to measure DNA-AGEs are reviewed. © 2006 Elsevier B.V. All rights reserved.},
author = {Bidmon, Clemens and Frischmann, Matthias and Pischetsrieder, Monika},
doi = {10.1016/j.Jchromb.2006.11.033},
faupublication = {yes},
journal = {Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences},
keywords = {Advanced glycation end-products; N2-(1-carboxyethyl)-2'-deoxyguanosine; CEdG A,B; DNA; LC–MS/MS},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.analys},
pages = {51-58},
peerreviewed = {Yes},
title = {{Analysis} of {DNA}-bound advanced glycation end-products by {LC} and mass spectrometry},
volume = {855},
year = {2007}
}
@article{faucris.120521544,
abstract = {Proteins or poly-L-lysine which were incubated in the presence of ascorbic acid, dehydroascorbic acid (ascorbylation), or various sugars (glycation) were analyzed by gas chromatography-mass spectrometry (GC-MS). To also detect more labile reaction products, the Maillard modified proteins or poly-L-lysine were enzymatically hydrolyzed and reacted with N-methyl-N-(tert-butyldimethylsilyl)-trifluoroacetamide to form the N(O)-tert-butyldimethylsilyl (tBDMS) derivatives prior to GC analysis. Under these conditions, the known Maillard products Nε-(carboxymethyl)lysine (1), oxalic acid mono-Nε-lysinylamide (2), and Nε-(carboxyethyl)lysine (3) could be simultaneously detected and quantified in glycated and ascorbylated proteins. Additionally, Nε-(1-carboxy-3-hydroxypropyl)-L-lysine (4) was identified for the first time as a Maillard product of proteins. Under the conditions applied here, 4 was found only in ascorbylated proteins or poly-L-lysine, but not in glycated proteins. Maillard-modified poly-L-lysine was further subjected to high-performance liquid chromatography (HPLC) analysis after enzymatic hydrolysis and formation of the phenyl isothiocyanate derivatized amino acids. Using this method, Nε-formyl-L-lysine (5), which cannot be distinguished from 2 by GC-MS analysis, was identified for the first time as a glycation product. Compound 5 is mainly formed from ribose, lactose, and fructose. The indicated Maillard products were quantified in β-lactoglobulin (GC-MS) or poly-L-lysine (HPLC) which were glycated or ascorbylated using different precursors.},
author = {Hasenkopf, Katrin and Rönner, Birgit and Hiller, Hartmut and Pischetsrieder, Monika},
doi = {10.1021/jf020411u},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Ascorbic acid; Ascorbylation; GC-MS; Glycation; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.analys},
pages = {5697-5703},
peerreviewed = {Yes},
title = {{Analysis} of {Glycated} and {Ascorbylated} {Proteins} by {Gas} {Chromatography}- {Mass} {Spectrometry}},
url = {http://pubs.acs.org/reprint-request?jf020411u/g44u},
volume = {50},
year = {2002}
}
@article{faucris.230226546,
abstract = {Furan fatty acids (F-acids) are a class of natural antioxidants with a
furan moiety in the acyl chain. These minor fatty acids have been
reported to occur with high proportions in the cholesteryl ester
fraction of fish livers. Here we present a method for the direct
analysis of intact cholesteryl esters with F-acids and other fatty acids
in cod liver lipids. For this purpose, the cholesteryl ester fraction
was isolated by solid phase extraction (SPE) and subsequently analyzed
by gas chromatography with mass spectrometry (GC/MS) using a
cool-on-column inlet. Pentadecanoic acid esterified with cholesterol was
used as an internal standard. GC/MS spectra of F-acid cholesteryl
esters featured the molecular ion along with characteristic fragment
ions for both the cholesterol and the F-acid moiety. All investigated
cod liver samples (n = 8) showed
cholesteryl esters of F-acids and, to a lower degree, of conventional
fatty acids. By means of GC/MS-SIM up to ten F-acid cholesteryl esters
could be determined in the samples. The concentrations of cholesteryl
esters with conventional fatty acids amounted to 78–140 mg/100 g lipids
(mean 97 mg/100 g lipids), while F-acid cholesteryl esters were present
at 47–270 mg/100 g lipids (mean 130 mg/100 g lipids},
author = {Hammann, Simon and Wendlinger, Christine and Vetter, Walter},
doi = {10.1007/s11745-015-4019-7},
faupublication = {no},
journal = {Lipids},
keywords = {Furan fatty acids; GC/MS; Cholesterol; Cod liver; Solid phase extraction; Steryl esters},
pages = {611-620},
peerreviewed = {Yes},
title = {{Analysis} of {Intact} {Cholesteryl} {Esters} of {Furan} {Fatty} {Acids} in {Cod} {Liver}},
url = {https://link.springer.com/article/10.1007/s11745-015-4019-7},
volume = {50},
year = {2015}
}
@article{faucris.117324504,
abstract = {The enzyme lysozyme is used as a preservative to prevent late blowing of ripened cheese, caused by Clostridium tyrobutyricum. Since the enzyme is extracted from hen egg white, lysozyme has to be declared on food product labels as a potential allergen. Here, a method is reported that combines immunocapture purification and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis for the detection of lysozyme in cheese samples. Cheese extracts were treated with magnetic particles coated with a monoclonal antibody directed against lysozyme. After immunocapture purification, lysozyme was detected by MALDI-TOF-MS. The limit of detection of the assay was about 5 mg/kg lysozyme in cheese. The method reliably distinguished between cheese samples which had been produced with and without lysozyme. Thus, the novel assay allows the reliable, sensitive, and specific detection of lysozyme in a food matrix. The assay could be easily adapted to other target peptides and proteins in complex food matrices and, therefore, has a broad application potential, e.g. for the analysis of allergens. © 2009 Elsevier B.V. All rights reserved.},
author = {Schneider, Nadine and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1016/j.jchromb.2009.07.040},
faupublication = {yes},
journal = {Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences},
keywords = {Cheese; Immunocapture mass spectrometry; Lysozyme; Matrix-assisted laser desorption/ionization mass spectrometry},
note = {UnivIS-Import:2015-03-09:Pub.2010.nat.dchph.llmch.analys},
pages = {201-206},
peerreviewed = {Yes},
title = {{Analysis} of lysozyme in cheese by immunocapture mass spectrometry},
volume = {878},
year = {2010}
}
@article{faucris.112378464,
abstract = {The peptides nisin A and nisin Z belong to type-A lantibiotics applied as preservatives in cheese production. The present study optimised and validated a liquid chromatography-tandem mass spectrometry (LCMS/MS) method for the analysis of nisin A in cheese. Since nisin A was not detectable in nisin-containing commercial cheese samples, an additional LCMS/MS method for the quantification of nisin Z was developed and validated. Quantification was performed by external calibration and standard addition. The latter method provided a non-significantly higher recovery rate for the tested cheese matrix. During the production of processed cheese, nisin A and nisin Z undergo significant degradation. Six degradation products of nisin A or nisin Z, respectively, were detected and assigned to nisin A/Z + H2O, nisin A/Z1-32, and nisin A/Z1-32 + H2O. In two out of eight commercial processed cheese samples, 1.6, resp. 1.7 mg nisin Z/kg cheese was measured, whereas nisin A was not detectable in any of the samples. © 2011 Elsevier Ltd. All rights reserved.},
author = {Pischetsrieder, Monika and Schneider, Nadine and Werkmeister, Knut},
doi = {10.1016/j.foodchem.2011.01.023},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Cheese; Lantibiotic; LCMS/MS; Nisin; Nisin degradation products; Nisin modifications},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.analys},
pages = {847-854},
peerreviewed = {Yes},
title = {{Analysis} of nisin {A}, nisin {Z} and their degradation products by {LCMS}/{MS}},
volume = {127},
year = {2011}
}
@article{faucris.118455524,
abstract = {Matrix-assisted laser desorption ionization-mass spectrometry with time-of-flight detection (MALDI-TOF/MS) is a promising tool to analyze advanced glycation end product (AGE)-modified proteins. The combination of soft ionisation (MALDI) with time-of-flight mass detection allows analysis of peptides and proteins of a molecular mass up to 300 kDa with minimal sample workup. Because the direct structural analysis of intact AGE proteins is not possible due to the formation of broad and poorly resolved peaks, peptide mapping was introduced into the analysis of AGE proteins by MALDI-TOF/MS, allowing site-specific analysis of defined AGEs. When methylglyoxal-modified lysozyme was subjected to MALDI-TOF/MS peptide mapping, methylimidazolone and argpyrimidine attached to the arginine residue and carboxyethyl (CEL) bound to the lysine were detected on peptideaa1-7 (KVFGRCE). In contrast, only one methylimidazolone was found on peptideaa8-35 (LAAAMKRHGLDNYRGYSLGNWVCAAKFE) and peptideaa120-129 (VQAWIRGCRL), respectively. The analysis of AGE protein, which had been incubated with glucose, revealed the presence of am Amadori product and a carboxymethyl residue (CML) on peptideaa1-7 and peptideaa8-35, as well as an imidazolone A on peptideaa120-129. Furthermore, the early Maillard reaction of lysozyme, which had been glycated by seven different sugars, was monitored by MALDI-TOF/MS peptide mapping. Finally, this approach was successfully applied for site- and product-specific relative quantification of AGEs. For example, kinetics of CML and Amadori product formation on peptide aa1-7, as well as imidazolone A formation on peptide aa120-129, were determined. © 2005 New York Academy of Sciences.},
author = {Kislinger, Thomas and Humeny, Andreas and Becker, Cord-Michael and Peich, Carlo and Pischetsrieder, Monika},
doi = {10.1196/annals.1333.030},
faupublication = {yes},
journal = {Annals of the New York Academy of Sciences},
keywords = {Advanced glycation end products; Maillard reaction; MALDI-TOF/MS; Mass spectrometry; Peptide mapping},
note = {UnivIS-Import:2015-04-16:Pub.2005.nat.dchph.llmch.analys},
pages = {249-259},
peerreviewed = {Yes},
title = {{Analysis} of {Protein} {Glycation} {Products} by {MALDI}-{TOF}/{MS}},
volume = {1043},
year = {2005}
}
@article{faucris.111179024,
abstract = {The term protein glycation summarizes non-enzymatic reactions between amino groups of proteins and sugars or sugar degradation products, leading to early glycation products (intact sugar attached) and advanced glycation end-products (AGEs). Protein glycation is involved in the progression of several diseases, such as diabetes, uremia, and atherosclerosis. However, qualitative and quantitative analysis of in vitro or in vivo glycated proteins is still a challenging task. The introduction of matrix-assisted laser desorption ionization time-of-flight technique (MALDI-TOF) changed mass spectrometry (MS) into a valuable tool for biomedical analysis, because the soft ionization procedure allows the measurement of proteins up to 100 kDa. In the last few years, MALDI-TOF-MS was applied to the investigation of glycation processes: the analyses of plasma proteins from diabetic or uremic patients allowed a precise determination of the average number of sugar residues attached to serum albumin or immunoglobulins of each patient. Thus, a more individualized diagnosis of each patient was achieved by MALDI-TOF-MS than by other diagnostic tools. In a similar way, the glycation rate of hemoglobin, isolated from diabetic blood and of β-2-microglobulin isolated from amyloid plaques from uremic patients was determined. The application of MALDI-TOF-MS for in vitro studies revealed important new insights into glycation mechanisms. Whereas the measurement of the intact proteins allows the determination of the average glycation rate, peptide mapping prior to MALDI-TOF-MS can reveal the exact structures of the glycation products and the glycation site. Furthermore, when the unmodified peptide is used as internal standard, MALDI-TOF-MS can also be used for reliable, site specific relative quantification of defined glycation products. © 2004 Bentham Science Publishers Ltd.},
author = {Kislinger, Thomas and Humeny, Andreas and Pischetsrieder, Monika},
doi = {10.2174/0929867043364649},
faupublication = {yes},
journal = {Current Medicinal Chemistry},
keywords = {Advanced glycation end-products; Amadori product; Maillard reaction; MALDI-TOF-MS; Mass spectrometry; Peptide mapping; Protein glycation},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.analys},
pages = {2185-2193},
peerreviewed = {Yes},
title = {{Analysis} of {Protein} {Glycation} {Products} by {Matrix}-{Assisted} {Laser} {Desorption} {Ionization} {Time}-of-{Flight} {Mass} {Spectrometry}},
volume = {11},
year = {2004}
}
@article{faucris.120678404,
abstract = {Sugar-sweetened carbonated soft drinks (CSDs) are broadly consumed worldwide. The added sugar, particularly high-fructose corn syrup (HFCS), can be an important source of sugar degradation products, such as α-dicarbonyl compounds. This study recorded the α-dicarbonyl profile in CSDs by ultrahigh-performance liquid chromatography with hyphenated diode array-tandem mass spectrometry after derivatization with o-phenylenediamine. Thus, 3-deoxy-d-erythro-hexos-2-ulose (3-DG), d-lyxo-hexos-2-ulose (glucosone), 3-deoxy-d-threo-hexos-2-ulose (3-DGal), 1-deoxy-d-erythro-hexos-2,3-diulose (1-DG), 3,4-dideoxyglucosone-3-ene (3,4-DGE), methylglyoxal, and glyoxal were identified as major α-dicarbonyls and, with the exception of glyoxal, quantified (recovery rates, 85.6-103.1%; RSD, 0.8-3.6%). Total α-dicarbonyl concentration in 25 tested commercial products ranged between 0.3 and 116 μg/mL and was significantly higher in HFCS-sweetened CSDs compared to CSDs sweetened with HFCS and sucrose or with sucrose alone. Predominant was 3-DG (≤87 μg/mL) followed by glucosone (≤21 μg/mL), 3-DGal (≤7.7 μg/mL), 1-DG (≤2.8 μg/mL), methylglyoxal (≤0.62 μg/mL), and 3,4-DGE (≤0.45 μg/mL). © 2013 American Chemical Society.},
author = {Gensberger, Sabrina and Glomb, Marcus and Pischetsrieder, Monika},
doi = {10.1021/jf3048466},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {α-dicarbonyl compounds (α-DCs); carbonated soft drinks (CSD); high-fructose corn syrup (HFCS); o-phenylenediamine (OPD); sugar degradation products},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.analys},
pages = {10238-10245},
peerreviewed = {Yes},
title = {{Analysis} of sugar degradation products with alpha-dicarbonyl structure in carbonated soft drinks by {UHPLC}-{DAD}-{MS}/{MS}},
url = {http://pubs.acs.org/articlesonrequest/AOR-EDsZR4bwUdRDMEFJqxdt},
volume = {61},
year = {2013}
}
@article{faucris.120776084,
abstract = {Milk is an excellent source of bioactive peptides. However, the composition of the native milk peptidome has only been partially elucidated. The present study applied matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) directly or after prefractionation of the milk peptides by reverse-phase high-performance liquid chromatography (RP-HPLC) or OFFGEL fractionation for the comprehensive analysis of the peptide profile of raw milk. The peptide sequences were determined by MALDI-TOF/TOF or nano-ultra-performance liquid chromatography-nanoelectrospray ionization-LTQ-Orbitrap-MS. Direct MALDI-TOF-MS analysis led to the assignment of 57 peptides. Prefractionation by both complementary methods led to the assignment of another 191 peptides. Most peptides originate from αS1-casein, followed by β-casein, and α S2-casein. κ-Casein and whey proteins seem to play only a minor role as peptide precursors. The formation of many, but not all, peptides could be explained by the activity of the endogenous peptidases, plasmin or cathepsin D, B, and G. Database searches revealed the presence of 22 peptides with established physiological function, including those with angiotensin-converting- enzyme (ACE) inhibitory, immunomodulating, or antimicrobial activity. © 2013 American Chemical Society.},
author = {Baum, Florian and Fedorova, Maria and Ebner, Jennifer and Hoffmann, Ralf and Pischetsrieder, Monika},
doi = {10.1021/pr4003273},
faupublication = {yes},
journal = {Journal of Proteome Research},
keywords = {bioactive peptides: milk; cathepsin; ESI-MS: caseins; HPLC prefractionation; MALDI-TOF-MS; OFFGEL fractionation; peptide profiling; plasmin},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.analys{\_}8},
pages = {5447-5462},
peerreviewed = {Yes},
title = {{Analysis} of the endogenous peptide profile of milk: {Identification} of 248 mainly casein-derived peptides},
url = {http://pubs.acs.org/articlesonrequest/AOR-2X56c2EdZb76MC49EC6C},
volume = {12},
year = {2013}
}
@article{faucris.121144584,
abstract = {In this study a new method was developed for analysis of the low molecular weight protein fraction of milk, allowing a simple and fast overview of the peptide profile of various milk samples. For this purpose, immobilized metal affinity chromatography (IMAC) was coupled with matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS). By this technique, two major peptides in milk could be identified as fragments of alpha-s1-casein. During heat treatment of raw milk, five new peptides were generated, the origin of which could be assigned to the casein fraction. Storage experiments with extended shelf life milk at 4 degrees C did not show any changes in the peptide profile, whereas in ultra high temperature milk stored at room temperature, one peptide increased significantly, which was identified as the N-terminus of alpha-s1-casein. The peptide was assumed to be formed in an enzymatic reaction, which was confirmed in a storage experiment with sterilized milk. Analyses of different commercially available milk samples confirmed the results obtained with the heated and stored milk. Furthermore, differences in the peptide profiles of the samples, probably due to different cow breeds or lactation stages, were observed. These results establish IMAC prior to MALDI-TOF-MS as a valid tool for the rapid analysis of the peptide profile of milk.},
author = {Meltretter, Jasmin and Schmidt, Alexander and Humeny, Andreas and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1021/jf073479o},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Milk; peptides; proteolysis; heat treatment; storage; immobilized metal affinity chromatography; matrix-assisted laser desorption/ionization mass pectrometry},
pages = {2899-2906},
peerreviewed = {Yes},
title = {{Analysis} of the peptide profile of milk and its changes during thermal treatment and storage},
volume = {56},
year = {2008}
}
@incollection{faucris.107111444,
address = {Cambridge},
author = {Lohwasser, Christina and Schuppan, Detlef and Pischetsrieder, Monika},
booktitle = {Biologically-Active Phytochemicals in Food},
editor = {Pfannhauser, W.; Fenwick, G.; Khokar, S.},
faupublication = {yes},
isbn = {0-85404-806-5},
note = {UnivIS-Import:2015-04-20:Pub.2001.nat.dchph.llmch.analyt},
pages = {149},
peerreviewed = {Yes},
publisher = {The Royal Society of Chemistry},
title = {{Analytical} {Methods} to {Determine} the {Influence} of {Maillard} {Products} on {Inflammatory} {Reactions} of {Hepatic} and {Intestinal} {Cells} in {Vitro}},
year = {2001}
}
@article{faucris.230224328,
abstract = {
Over the past three
decades, studies of ancient biomolecules—particularly ancient DNA,
proteins, and lipids—have revolutionized our understanding of
evolutionary history. Though initially fraught with many challenges,
today the field stands on firm foundations. Researchers now successfully
retrieve nucleotide and amino acid sequences, as well as lipid
signatures, from progressively older samples, originating from
geographic areas and depositional environments that, until recently,
were regarded as hostile to long-term preservation of biomolecules.
Sampling frequencies and the spatial and temporal scope of studies have
also increased markedly, and with them the size and quality of the data
sets generated. This progress has been made possible by continuous
technical innovations in analytical methods, enhanced criteria for the
selection of ancient samples, integrated experimental methods, and
advanced computational approaches. Here, we discuss the history and
current state of ancient biomolecule research, its applications to
evolutionary inference, and future directions for this young and
exciting field.
},
author = {Cappellini, Enrico and Prohaska, Ana and Racimo, Fernando and Welker, Frido and Pedersen, Mikkel Winther and Allentoft, Morten E. and Damgaard, Peter De Barros and Gutenbrunner, Petra and Dunne, Julie and Hammann, Simon and Roffet-Salque, Melanie and Ilardo, Melissa and Moreno-Mayar, J. Victor and Wang, Yucheng and Sikora, Martin and Vinner, Lasse and Cox, Juergen and Evershed, Richard P. and Willerslev, Eske},
doi = {10.1146/annurev-biochem-062917-012002},
faupublication = {no},
journal = {Annual Review of Biochemistry},
keywords = {ancient DNA; paleogenomics; ancient proteins; ancient lipids; ancient genomics; paleoproteomics},
pages = {1029-1060},
peerreviewed = {unknown},
title = {{Ancient} {Biomolecules} and {Evolutionary} {Inference}},
url = {https://www.annualreviews.org/doi/abs/10.1146/annurev-biochem-062917-012002},
volume = {87},
year = {2018}
}
@incollection{faucris.239802449,
abstract = {The application of chromatographic and mass spectrometric techniques for the analysis of archaeological artifacts enables researchers to investigate diets and health of past populations, where no written records are available. Through the analysis of preserved organic residue (mainly lipids) in human remains and cultural goods, most importantly cooking vessels, food sources and preparation strategies can be identified and distinguished. This is based on extensive reference work, cooking and degradation experiments, to account for molecular changes over archaeological timescale. In this way the emergence of food sources and their importance for human life can be investigated with temporal and spatial resolution.
8 compounds, glycerophospholipids, glycerolipids (i.e., glycolipids, betaine lipids, and triglycerides), sphingolipids, sterols, sercosterols (vitamin D), isoprenoids (i.e., carotenoids and retinoids (vitamin A)), quinones (i.e., coenzyme Q, vitamin K, and vitamin E), terpenes, oxidized lipids, and oxylipin are highlighted. The uniqueness of each food group: oil-, protein-, and starch-rich, as well as marine foods, fruits, and vegetables (water-rich) regarding its lipid composition, is included. The effect of cooking, food processing, and storage, in addition to the importance of lipidomics in food quality and authenticity, are also discussed. A critical review of challenges and future trends of the analytical approaches and computational methods in global food lipidomics as the basis to increase consumer awareness of the significant role of lipids in food quality and food security worldwide is presented.},
author = {Tietel, Zipora and Hammann, Simon and Meckelmann, Sven W. and Ziv, Carmit and Pauling, Josch K. and Wölk, Michele and Würf, Vivian and Alves, Eliana and Neves, Bruna and Domingues, M. Rosário},
doi = {10.1111/1541-4337.13225},
faupublication = {yes},
journal = {Comprehensive Reviews in Food Science and Food Safety},
keywords = {authenticity; computational methods; food, food quality; lipidomics; lipids; nutrients},
note = {CRIS-Team Scopus Importer:2023-09-15},
peerreviewed = {Yes},
title = {{An} overview of food lipids toward food lipidomics},
year = {2023}
}
@article{faucris.253937498,
abstract = {The fight against food waste benefits from novel agents inhibiting spoilage. The present study investigated the preservative potential of the antimicrobial peptides Leg1 (RIKTVTSFDLPALRFLKL) and Leg2 (RIKTVTSFDLPALRWLKL) recently identified in chickpea legumin hydrolysates. Checkerboard assays revealed strong additive antimicrobial effects of Leg1/Leg2 with sodium benzoate against Escherichia coli and Bacillus subtilis with fractional inhibitory concentrations of 0.625 and 0.75. Additionally, Leg1/Leg2 displayed antifungal activity with minimum inhibitory concentrations of 500/250 µM against Saccharomyces cerevisiae and 250/125 µM against Zygosaccharomyces bailii. In contrast, no cytotoxic effects were observed against human Caco-2 cells at concentrations below 2000 µM (Leg1) and 1000 µM (Leg2). Particularly Leg2 showed antioxidative activity by radical scavenging and reducing mechanisms (maximally 91.5/86.3% compared to 91.2/94.7% for the control ascorbic acid). The present results demonstrate that Leg1/Leg2 have the potential to be applied as preservatives protecting food and other products against bacterial, fungal and oxidative spoilage.},
author = {Heymich, Marie-Louise and Nißl, Laura and Hahn, Dominik and Noll, Matthias and Pischetsrieder, Monika},
doi = {10.3390/foods10030585},
faupublication = {yes},
journal = {Foods},
keywords = {Antifungal activity; Antimicrobial peptides; Antioxidative peptides; Chickpea peptides; Cytotoxicity; Leg1; Leg2},
note = {CRIS-Team Scopus Importer:2021-04-02},
peerreviewed = {Yes},
title = {{Antioxidative}, antifungal and additive activity of the antimicrobial peptides leg1 and leg2 from chickpea},
volume = {10},
year = {2021}
}
@article{faucris.116743484,
abstract = {Protein mass spectometry techniques, such as electrospray ionization mass spectrometry or matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS), are effective methods to screen for protein modifications derived from the Maillard reaction. The analysis of the intact proteins reveals the major modification, most commonly the Amadori product, whereas partial enzymatic hydrolysis prior to mass spectrometry additionally allows the detection of minor adducts. Therefore, a mass spectrometric method was developed for the analysis of whey protein modifications occurring during heat treatment. The two main whey proteins, α-lactalbumin and β-lactoglobulin, were incubated with lactose in a milk model and modifications were recorded using MALDI-TOF-MS. The analysis of the intact proteins revealed protein species with 0-4 lactulosyl residues. Partial enzymatic hydrolysis with endoproteinase AspN prior to mass spectrometric analysis enabled the detection of further modifications and their localization in the amino acid sequence. Detected modifications were lactulosyllysine, N ε-(carboxymethyl)lysine, lysine aldehyde, methionine sulfoxide, cyclization of N-terminal glutamic acid to a pyrrolidone, and oxidation of cysteine or tryptophan. Protein modifications in heated milk and commercially available dairy products can be analyzed after the separation of the milk proteins using one-dimensional SDS-PAGE. © 2008 New York Academy of Sciences.},
author = {Meltretter, Jasmin and Pischetsrieder, Monika},
doi = {10.1196/annals.1433.022},
faupublication = {yes},
journal = {Annals of the New York Academy of Sciences},
keywords = {α-lactalbumin; β-lactoglobulin; Advanced glycation end products; Maillard reaction; Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry; Milk products; Oxidation},
note = {UnivIS-Import:2015-03-09:Pub.2008.nat.dchph.llmch.applic},
pages = {134-140},
peerreviewed = {Yes},
title = {{Application} of mass spectrometry for the detection of glycation and oxidation products in milk proteins},
volume = {1126},
year = {2008}
}
@phdthesis{faucris.270321567,
author = {Dalabasmaz, Sevim},
faupublication = {yes},
peerreviewed = {automatic},
school = {Friedrich-Alexander-Universität Erlangen-Nürnberg},
title = {{Application} of peptide profiling for the evaluation of milk processing and storage},
year = {2018}
}
@article{faucris.111869384,
author = {Hocke, Carsten and Maschauer, Simone and Hübner, Harald and Löber, Stefan and Utz, Wolfgang and Kuwert, Torsten and Gmeiner, Peter and Prante, Olaf},
doi = {10.1002/cmdc.201000067},
faupublication = {yes},
journal = {ChemMedChem},
pages = {941-948},
peerreviewed = {Yes},
title = {{A} series of {18F}-labelled pyridinylphenyl amides as subtype-selective radioligands for the dopamine {D3} receptor},
volume = {5},
year = {2010}
}
@article{faucris.111985544,
abstract = {The formation of the Amadori product from lactose (protein lactosylation) is a major parameter to evaluate the quality of processed milk. Here, MALDI-TOF-MS was used for the relative quantification of lactose-adducts in heated milk. Milk was heated at a temperature of 70, 80, and 1001C between 0 and 300min, diluted, and subjected directly to MALDI-TOF-MS. The lactosylation rate of a-lactalbumin increased with increasing reaction temperature and time. The results correlated well with established markers for heat treatment of milk (concentration of total soluble protein, soluble a-lactalbumin and b-lactoglobulin at pH 4.6, and fluorescence of advanced Maillard products and soluble tryptophan index; r = 0.969-0.997). The method was also applied to examine commercially available dairy products. In severely heated products, protein pre-purification by immobilized metal affinity chromatography improved spectra quality. Relative quantification of protein lactosylation by MALDI-TOF-MS proved to be a very fast and reliable method to monitor early Maillard reaction during milk processing. © 2009 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.},
author = {Meltretter, Jasmin and Birlouez-Aragon, Inés and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200900008},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Amadori product; Maillard reaction; MALDI-TOF-MS; Milk; Relative quantification},
note = {UnivIS-Import:2015-03-09:Pub.2009.nat.dchph.llmch.assess},
pages = {1487-1495},
peerreviewed = {Yes},
title = {{Assessment} of heat treatment of dairy products by {MALDI}-{TOF}-{MS}},
volume = {53},
year = {2009}
}
@article{faucris.111179904,
abstract = {The typical formulation of infant formulas (IF) may enhance damage of proteins during spray drying or sterilization. Lactose reacts with amino groups of proteins resulting in the formation of lactulosyllysine (LL). The latter is further degraded to give advanced glycation end-products (AGEs). Furthermore, oxidation reactions, which are catalyzed by iron can further promote AGE formation. In this study, six parameters for protein modification were measured for 41 commercially available IF samples: lysine blockage, tryptophan degradation and LL formation by HPLC, the AGEs Nε- carboxymethyllysine (CML) and oxalic acid monoalkylamide (OMA) by ELISA. The FAST index was used as a rapid method for monitoring AGEs. IF showed increased lysine loss (6-fold), LL formation (2-3-fold) and AGEs levels (3-5 times) (CML, OMA, and FAST index) compared to similarly treated cow's milk, indicating more severe protein modifications in the former. Further studies on the technological processes are required to minimize heat-induced damage of IF during manufacturing. © 2004 Elsevier Ltd. All rights reserved.},
author = {Birlouez-Aragon, Inés and Pischetsrieder, Monika and Leclère, J. and Morales, Francesco and Hasenkopf, Katrin and Kientsch-Engel, Rose and Ducauze, Christian J. and Rutledge, Doug},
doi = {10.1016/j.foodchem.2003.11.019},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Advanced glycation end-products; Carboxymethyllysine; Fluorescence; Infant formulas; Lactulosyllysine; Nutritional quality; Protein glycation},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.assess},
pages = {253-259},
peerreviewed = {Yes},
title = {{Assessment} of protein glycation markers in infant formulas},
volume = {87},
year = {2004}
}
@article{faucris.111855744,
abstract = {Mycelial colonies of filamentous fungi often deteriorate when maintained on artificial media, and this can take the form of sterile sectors. We previously established that sectorization by the entomopathogenic fungus Metarhizium anisopliae correlates with intracellular accumulation of reactive oxygen species (ROS). In this study we demonstrate that: (1) H2O2 increases rates of sectorization; (2) a stable strain of M. anisopliae eliminates intracellular ROS more rapidly than an unstable strain; (3) mitochondrial DNA from sectors undergoes a non-enzymatic glycation of deoxyguanosine that is not shown by genomic DNA; (4) the membrane potential of mitochondria in sector cells is decreased in comparison to wild type cells indicating loss of function; (5) DNA glycation changes the properties of DNA and (6) treating wild type mycelia with H2O2 reproduced the glycation pattern shown in sectors. H2O2 also reproduced the morphological changes in mitochondria and lipid droplets that occur in sector cells. Fungal sectorization thus displays aging related developmental impairments resulting from oxidative stress, suggesting a new research direction for studies on fungal colony deterioration. Mitochondrial DNA has a very high AT bias. We speculate that reducing the consequences of glycation could provide an adaptive reason for this. © 2008 Elsevier Inc.},
author = {Li, Lin and Pischetsrieder, Monika and St. Leger, Raymond J. and Wang, Chengshu},
doi = {10.1016/j.fgb.2008.06.003},
faupublication = {yes},
journal = {Fungal Genetics and Biology},
keywords = {Lipid droplets; Metarhizium anisopliae; mtDNA glycation; Oxidative stress; Sectorization},
note = {UnivIS-Import:2015-03-09:Pub.2008.nat.dchph.llmch.associ},
pages = {1300-1306},
peerreviewed = {Yes},
title = {{Associated} links among {mtDNA} glycation, oxidative stress and colony sectorization in {Metarhizium} anisopliae},
volume = {45},
year = {2008}
}
@article{faucris.290006551,
abstract = {Ketamine shows rapid antidepressant effects peaking 24 h after administration. The antidepressant effects may occur through changes in glutamatergic metabolite levels and resting-state functional connectivity (rsFC) within the default mode network (DMN). A multistage drug effect of ketamine has been suggested, inducing acute effects on dysfunctional network configuration and delayed effects on homeostatic synaptic plasticity. Whether the DMN-centered delayed antidepressant-related changes are associated with the immediate changes remains unknown. Thirty-five healthy male participants (25.1 ± 4.2 years) underwent 7 T magnetic resonance spectroscopy (MRS) and resting-state functional magnetic resonance imaging (rsfMRI) before, during, and 24 h after a single S-ketamine or placebo infusion. Changes in glutamatergic measures and rsFC in the DMN node pregenual anterior cingulate cortex (pgACC) were examined. A delayed rsFC decrease of the pgACC to inferior parietal lobe (family-wise error corrected p (pFWEc) = 0.018) and dorsolateral prefrontal cortex (PFC; pFWEc = 0.002) was detected that was preceded by an immediate rsFC increase of the pgACC to medial PFC (pFWEc < 0.001) and dorsomedial PFC (pFWEc = 0.005). Additionally, the immediate rsFC reconfigurations correlated with the delayed pgACC glutamate (Glu) level increase (p = 0.024) after 24 h at trend level (p = 0.067). Baseline measures of rsFC and MRS were furthermore associated with the magnitude of the respective delayed changes (p’s < 0.05). In contrast, the delayed changes were not associated with acute psychotomimetic side effects or plasma concentrations of ketamine and its metabolites. This multimodal study suggests an association between immediate S-ketamine-induced network effects and delayed brain changes at a time point relevant in its clinical context.},
author = {Danyeli, Lena Vera and Sen, Zümrüt Duygu and Colic, Lejla and Kurzweil, Lisa and Gensberger-Reigl, Sabrina and Macharadze, Tamar and Götting, Florian and Refisch, Alexander and Liebe, Thomas and Chand, Tara and Kretzschmar, Moritz and Wagner, Gerd and Opel, Nils and Jollant, Fabrice and Speck, Oliver and Munk, Matthias H.J. and Li, Meng and Walter, Martin},
doi = {10.1038/s41398-023-02346-0},
faupublication = {yes},
journal = {Translational Psychiatry},
note = {CRIS-Team Scopus Importer:2023-03-03},
peerreviewed = {Yes},
title = {{Association} of the delayed changes in glutamate levels and functional connectivity with the immediate network effects of {S}-ketamine},
volume = {13},
year = {2023}
}
@article{faucris.270514978,
author = {Dalabasmaz, Sevim and Pischetsrieder, Monika},
doi = {10.1002/lemi.202151006},
faupublication = {yes},
journal = {Lebensmittelchemie},
peerreviewed = {unknown},
title = {{A} systematic approach to identify novel marker peptides for the heat treatment and storage of milk},
volume = {75},
year = {2021}
}
@article{faucris.310120414,
abstract = {Ancient Egyptian mummification was practiced for nearly 4000 years as a key feature of some of the most complex mortuary practices documented in the archaeological record. Embalming, the preservation of the body and organs of the deceased for the afterlife, was a central component of the Egyptian mummification process. Here, we combine GC–MS, HT-GC–MS, and LC–MS/MS analyses to examine mummification balms excavated more than a century ago by Howard Carter from Tomb KV42 in the Valley of the Kings. Balm residues were scraped from now empty canopic jars that once contained the mummified organs of the noble lady Senetnay, dating to the 18th dynasty, ca. 1450 BCE. Our analysis revealed balms consisting of beeswax, plant oil, fats, bitumen, Pinaceae resins, a balsamic substance, and dammar or Pistacia tree resin. These are the richest, most complex balms yet identified for this early time period and they shed light on balm ingredients for which there is limited information in Egyptian textual sources. They highlight both the exceptional status of Senetnay and the myriad trade connections of the Egyptians in the 2nd millennium BCE. They further illustrate the excellent preservation possible even for organic remains long removed from their original archaeological context.},
author = {Huber, B. and Hammann, Simon and Loeben, C. E. and Jha, D. K. and Vassão, D. G. and Larsen, T. and Spengler, R. N. and Fuller, D. Q. and Roberts, P. and Devièse, T. and Boivin, N.},
doi = {10.1038/s41598-023-39393-y},
faupublication = {yes},
journal = {Scientific Reports},
note = {CRIS-Team Scopus Importer:2023-09-08},
peerreviewed = {Yes},
title = {{Biomolecular} characterization of 3500-year-old ancient {Egyptian} mummification balms from the {Valley} of the {Kings}},
volume = {13},
year = {2023}
}
@article{faucris.122157244,
abstract = {Hierarchically porous bioactive glass particles (BGPs) were synthesized by a facile sol-gel process using pollen grains as the templates. The synthesized pollen-templated bioactive glass particles (PBGPs) exhibited dual macro-nano porous structure. The macro pores (~1μm) were inherited from the template of pollen grains while the nano pores (~9.5nm) were induced by the intrinsic mechanism of the sol-gel process. PBGPs possessed a high specific surface area (111.4m/g) and pore volume (0.35cm/g). Hydroxyapatite (HA) formation on PBGPs was detected within 3 days after immersion in simulated body fluid (SBF). Due to their larger specific surface area and pore volume, PBGPs could be loaded with more tetracycline hydrochloride (TCH) than non-templated BGPs and conventional melt-derived 45S5 BGPs. In addition, PBGPs exhibited a low initial burst release (within 10% of the loaded amount) within 18h and a sustained release with a two-stage release pattern for up to 6 days in phosphate buffered saline (PBS). The antibacterial assay confirmed that the TCH-loaded PBGPs could release TCH within 5 days, and the released TCH could reach the minimum inhibitory concentration (MIC) against Escherichia coli. MTT assay indicated that PBGPs showed non-cytotoxic effects toward human hepatocellular carcinoma (Hep G2) cells after co-culture for up to 72h in vitro. These results showed that the biocompatible hierarchically macro-nano porous PBGPs are potential for bone regeneration and local drug delivery applications.},
author = {Zheng, Kai and Bortuzzo, Judith Agnes and Liu, Yufang and Li, Wei and Pischetsrieder, Monika and Roether, Judith and Lu, Miao and Boccaccini, Aldo R.},
doi = {10.1016/j.colsurfb.2015.03.038},
faupublication = {yes},
journal = {Colloids and Surfaces B: Biointerfaces},
keywords = {Bio-template; Bioactive glass; Drug delivery; Hierarchical pores},
pages = {825-832},
peerreviewed = {unknown},
title = {{Bio}-templated bioactive glass particles with hierarchical macro-nano porous structure and drug delivery capability},
volume = {135},
year = {2014}
}
@article{faucris.257932326,
author = {Spitzer, Johanna and Büttner, Andrea},
doi = {10.1016/j.foodchem.2009.10.015},
faupublication = {yes},
journal = {Food Chemistry},
peerreviewed = {Yes},
title = {{Characterization} of aroma changes in human milk during storage at -19 °{C}.},
volume = {120},
year = {2010}
}
@article{faucris.256967613,
author = {Wiedmer, Christoph and Velasco-Schön, Cristina and Büttner, Andrea},
doi = {10.1038/s41598-017-01720-5},
faupublication = {yes},
journal = {Scientific Reports},
peerreviewed = {Yes},
title = {{Characterization} of off-odours and potentially harmful substances in a fancy dress accessory handbag for children.},
year = {2017}
}
@article{faucris.112579984,
abstract = {Fibrosis and vascular sclerosis are main complications that limit the long-term application of peritoneal dialysis (PD). Low biocompatibility has been largely attributed to the presence of glucose degradation products (GDPs), which are formed during the heat sterilization of PD fluids. GDPs readily modify proteins in the peritoneum, leading to a decline of their biological function. After absorption, GDPs can also promote systemic protein glycation. Additionally, GDPs may augment DNA glycation, a process enhanced in uremia. Apart from their glycating activity, GDPs induce cytotoxicity and interfere with cell signaling in peritoneal mesothelial cells. Targeted screening revealed the nature of the6major GDPs with α-dicarbonyl structure as 3-deoxyglucosone, 3-deoxygalactosone, glucosone, glyoxal, methylglyoxal, and 3,4-dideoxyglucosone-3-ene. Valid quantification of these GDPs was achieved by ultrahigh-performance liquid chromatography/diode array detector/tandem mass spectrometry. Identification and quantification of single GDPs allow a structure-dependent risk evaluation. As a consequence, PD fluids and processes can be improved to reduce the GDP burden of patients undergoing PD. © 2012 National Kidney Foundation, Inc.},
author = {Mittelmaier, Stefan and Niwa, Toshimitsu and Pischetsrieder, Monika},
doi = {10.1053/j.jrn.2011.10.014},
faupublication = {yes},
journal = {Journal of Renal Nutrition},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.chemic},
pages = {181-185},
peerreviewed = {Yes},
title = {{Chemical} and physiological relevance of glucose degradation products in peritoneal dialysis},
volume = {22},
year = {2012}
}
@article{faucris.121243144,
abstract = {Dihydrogen sulfide recently emerged as a biological signaling molecule with important physiological roles and significant pharmacological potential. Chemically plausible explanations for its mechanisms of action have remained elusive, however. Here, we report that HS reacts with S-nitrosothiols to form thionitrous acid (HSNO), the smallest S-nitrosothiol. These results demonstrate that, at the cellular level, HSNO can be metabolized to afford NO, NO, and NO species, all of which have distinct physiological consequences of their own. We further show that HSNO can freely diffuse through membranes, facilitating transnitrosation of proteins such as hemoglobin. The data presented in this study explain some of the physiological effects ascribed to HS, but, more broadly, introduce a new signaling molecule, HSNO, and suggest that it may play a key role in cellular redox regulation. © 2012 American Chemical Society.},
author = {Filipovic, Milos and Miljkovic, Jan and Nauser, Thomas and Royzen, Maksim and Klos, Katharina and Shubina, Tatyana and Koppenol, Willem H. and Lippard, Stephen J. and Ivanovic-Burmazovic, Ivana},
doi = {10.1021/ja3009693},
faupublication = {yes},
journal = {Journal of the American Chemical Society},
pages = {12016-12027},
peerreviewed = {Yes},
title = {{Chemical} characterization of the smallest {S}-nitrosothiol, {HSNO}; {Cellular} cross-talk of {H2S} and {S}-nitrosothiols},
volume = {134},
year = {2012}
}
@article{faucris.123257464,
abstract = {Carbohydrate degradation products are formed during heat sterilization in
drugs containing (poly-)glucose as osmotic agents. Given this situation,
peritoneal dialysis fluids (PDFs) and infusion fluids are of particular
clinical relevance, because these drugs deliver process contaminants either
over a longer period or directly into the circulation of patients who are
critically ill. For the development of suitable mitigation strategies, it is
important to understand the reaction mechanisms of carbohydrate
degradation during sterilization and how the resulting products interact
with physiological targets at the molecular level. Furthermore, reliable,
comprehensive, and highly sensitive quantification methods are required
for product control and toxicological evaluation.},
author = {Pischetsrieder, Monika and Gensberger-Reigl, Sabrina and Atzenbeck, Lisa and Weigel, Ingrid},
doi = {10.1016/j.drudis.2016.06.011},
faupublication = {yes},
journal = {Drug Discovery Today},
pages = {1620-1631},
peerreviewed = {Yes},
title = {{Chemistry} and {Clinical} {Relevance} of {Carbohydrate} {Degradation} in {Drugs}},
volume = {21},
year = {2016}
}
@article{faucris.117261804,
abstract = {Glucose degradation, yielding GDPs, can take place in vivo or during heat treatment of glucose solutions. AGEs are formed from the interaction of D-glucose with reactive amino-acid side chains of proteins. Both GDPs and AGEs have been shown to impair cellular function. GDPs have additional damaging effects because they strongly promote AGE formation (as compared to D-glucose).},
author = {Pischetsrieder, Monika},
faupublication = {yes},
journal = {Peritoneal Dialysis International},
keywords = {3-Deoxyglucosone; Advanced glycation end-products; Amadori product; Glucose degradation products},
note = {UnivIS-Import:2015-03-06:Pub.2000.nat.dchph.llmch.chemis},
pages = {26-30},
peerreviewed = {Yes},
title = {{Chemistry} of glucose and biochemical pathways of biological interest},
volume = {20},
year = {2000}
}
@article{faucris.255810252,
author = {Gensberger-Reigl, Sabrina and Konopa, Andreas},
faupublication = {yes},
journal = {Deutsche Lebensmittel-Rundschau},
note = {CRIS-Team Scopus Importer:2021-04-20},
peerreviewed = {Yes},
title = {{Chloratrückstände} - {Optimierung} von {Reinigungsprozessen} basierend auf der quantitativen {Analyse} von {Chlorat}},
volume = {115},
year = {2019}
}
@article{faucris.230224689,
abstract = {Cholesterol is generally absent in animal
fat residues preserved in archaeological ceramic vessels. It is known
from edible oil refining that during bleaching with activated clay
sterols are degraded, largely via oxidation. Laboratory heating
experiments using fired clay from replica pottery vessels promoted
rapid degradation of cholesterol via oxidation. Furthermore,
heating cholesterol with fatty acids (saturated and unsaturated)
revealed additional degradation to occur independently of the ceramic
matrix. As both conditions are met in archaeological pottery during
animal (and plant) product processing involving heating, the very rare
detection of sterols in organic residues can be explained.
},
author = {Hammann, Simon and Cramp, Lucy J. E. and Whittle, Mathilda and Evershed, Richard P.},
doi = {10.1016/j.tetlet.2018.10.071},
faupublication = {no},
journal = {Tetrahedron Letters},
keywords = {Archaeology; Fatty acids; Fired Clay; Cholesterol; Degradation; Organic residues},
pages = {4401-4404},
peerreviewed = {Yes},
title = {{Cholesterol} degradation in archaeological pottery mediated by fired clay and fatty acid pro-oxidants},
url = {https://www.sciencedirect.com/science/article/pii/S0040403918313121},
volume = {59},
year = {2018}
}
@article{faucris.301461328,
abstract = {In this study, we discussed covalent and non-covalent reactions between cocoa polyphenols and proteins (milk and cocoa) and the possible effects of these reactions on their bioaccessibility, considering environmental and processing conditions. Better insight into these interactions is crucial for understanding the biological effects of polyphenols, developing nutritional strategies, and improving food processing and storage. Protein-polyphenol reactions affect the properties of the final product and can lead to the formation of various precursors at various stages in the manufacturing process, such as fermentation, roasting, alkalization, and conching. Due to the complex composition of the chocolate and the various technological processes, comprehensive food profiling strategies should be applied to analyze protein-polyphenol covalent reactions covering a wide range of potential reaction products. This will help to identify potential effects on the bioaccessibility of bioactive compounds such as low-molecular-weight peptides and polyphenols. To achieve this, databases of potential reaction products and their binding sites can be generated, and the effects of various process conditions on related parameters can be investigated. This would then allow to a deeper insight into mechanisms behind protein-polyphenol interactions in chocolate, and develop strategies to optimize chocolate production for improved nutritional and sensory properties.},
author = {Dalabasmaz, Sevim and Toker, Ömer Said and Palabiyik, Ibrahim and Konar, Nevzat},
doi = {10.1080/10408398.2023.2207661},
faupublication = {yes},
journal = {Critical Reviews in Food Science and Nutrition},
keywords = {Chocolate; cocoa; polyphenol; protein},
note = {CRIS-Team Scopus Importer:2023-05-19},
peerreviewed = {Yes},
title = {{Cocoa} polyphenols and milk proteins: covalent and non-covalent interactions, chocolate process and effects on potential polyphenol bioaccesibility},
year = {2023}
}
@article{faucris.111380764,
abstract = {In this study, we investigated the immunomodulatory activity of coffee and Maillard reaction products on macrophages in vitro. Stimulation of macrophages with coffee, but not with raw coffee extract in PBS, led to a 13-fold increased nuclear NF-jB translocation. A Maillard reaction mixture (25 mM D-ribose/L-lysine, 30 min at 1208C) increased NF-jB translocation 18-fold (in PBS) or six-fold (in medium). MRPs also induced a two-fold increased NF-jB translocation in untransfected human embryonic kidney (HEK) cells as well as in HEK cells stably transfected with the receptor for advanced glycation endproducts (RAGE), indicating that the effect was not RAGE mediated. On the other hand, catalase totally abolished coffee- and MRP-induced NF-jB translocation. Consequently, up to 366 lM hydrogen peroxide was measured in the coffee preparation and Maillard mixtures used for cell stimulation. Stimulation of macrophages with MRPs did not lead to significantly increased IL-6 or NO release. Thus, it can be concluded that coffee and MRPs induce NF-jB translocation in macrophages via the generation of hydrogen peroxide.},
author = {Muscat, Sonja and Pelka, Joana and Hegele, Jörg and Weigle, Bernd and Münch, Gerald and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200600254},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Coffee; Hydrogen peroxide; Immunomodulation; Maillard reaction products; NF-kappaB},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.coffee},
pages = {525-535},
peerreviewed = {Yes},
title = {{Coffee} and {Maillard} products activate {NF}-{kappaB} in macrophages via {H2O2} production},
volume = {51},
year = {2007}
}
@article{faucris.118933364,
abstract = {Taking advantage of our in-house experimental data on dopamine D3 receptor modulators, we have successfully established highly significant CoMFA and CoMSIA models (qcv2 = 0.82 / 0.76). These models were carefully investigated to assure their stability and predictivity (rpred2 = 0.65 / 0.61) and subsequently applied to guide experimental investigations on the synthesis and receptor binding of three conformationally restricted D3 ligands. Besides the high D3 affinity, the test compound 45, incorporating a trans-1,4-cyclohexylene partial structure, exhibited improved (∼3200-fold) selectivity over the D4 subtype. © 2006 Elsevier Ltd. All rights reserved.},
author = {Hübner, Harald and Gmeiner, Peter and Utz, Wolfgang and et al.},
author_hint = {Salama Ismail, Schlotter Karin, Utz Wolfgang, Hübner Harald, Gmeiner Peter, Böckler Frank},
doi = {10.1016/j.bmc.2006.05.025},
faupublication = {yes},
journal = {Bioorganic & Medicinal Chemistry},
keywords = {3D-QSAR; CoMFA/CoMSIA model; Dopamine D3 Receptor; Phenylpiperazine},
note = {UnivIS-Import:2015-03-09:Pub.2006.nat.dchph.lphch.comfaa},
pages = {5898-5912},
peerreviewed = {Yes},
support_note = {Author relations incomplete. You may find additional data in field 'author{\_}hint'},
title = {{CoMFA} and {CoMSIA} {Investigations} of {Dopamine} {D3} {Receptor} {Ligands} {Leading} to the {Prediction}, {Synthesis} and {Evaluation} of {Rigidized} {FAUC} 365 {Analogues}},
volume = {14},
year = {2006}
}
@article{faucris.116751184,
abstract = {As an extension of a series of dopamine D3 receptor agonists involving FAUC 54, ex-chiral pool synthesis, and biological evaluation of 3-substituted 7-aminotetrahydroindolizines was performed. Considering the structural features of both series of enantiomers, we developed a novel alignment hypothesis for D3 agonists, allowing for the placement of the aromatic moieties on two alternative, adjacent positions. CoMFA and CoMSIA analyses yielded significant cross-validated q2 values of 0.726 and 0.590, respectively, when a newly invented program application (IRAS) controlling the alignment selection proved to be useful. Employing the CoMFA/CoMSIA contribution maps, we were able to transform a previously constructed homology model of the D3 receptor from an inactive into an activate state. Besides the established ionic interactions, we propose π-stacking with Phe6.51 and a hydrogen bond between His6.55 and the acyl moiety to be primarily involved in the D3 receptor binding of FAUC 54 and its analogues. © 2005 American Chemical Society.},
author = {Hübner, Harald and Gmeiner, Peter and Utz, Wolfgang and et al.},
author_hint = {Böckler Frank, Ohnmacht Ursula, Lehmann Thomas, Utz Wolfgang, Hübner Harald, Gmeiner Peter},
doi = {10.1021/jm049269+},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.lphch.comfaa},
pages = {2493-2508},
peerreviewed = {Yes},
support_note = {Author relations incomplete. You may find additional data in field 'author{\_}hint'},
title = {{CoMFA} and {CoMSIA} {Investigations} {Revealing} {Novel} {Insights} into the {Binding} {Modes} of {Dopamine} {D3} {Receptor} {Agonists}},
volume = {48},
year = {2005}
}
@article{faucris.221882807,
abstract = {Microplastics in food is a relatively new research field with only few studies available so far. Scientists have been pointing out that some of these studies apply questionable analytical methods. Nevertheless, media often use such results to gain attention of the readers. It is therefore of particular significance, that only those scientific studies are published, clearly presenting valid data on the content of microplastics in food. Unfortunately, the study by Zuccarello et al. shows very critical aspects regarding analytical methods used and conclusions made. The applied procedure is not described and, therefore, does not allow any assessment by other groups, which is indispensable prerequisite of any scientific publication. Moreover, the analytical method used for the identification and quantification of microplastic particles – SEM-EDX – is not sound and not validated. Therefore, in our opinion the results on the contamination of bottled mineral water with microplastics published by Zuccarello et al. are more than questionable.},
author = {Oßmann, Barbara and Schymanski, Darena and Ivleva, Natalia P. and Fischer, Dieter and Fischer, Franziska and Dallmann, Gerald and Welle, Frank},
doi = {10.1016/j.watres.2019.06.032},
faupublication = {yes},
journal = {Water Research},
keywords = {Bottled mineral water; Microplastics; PET bottles},
note = {CRIS-Team Scopus Importer:2019-07-09},
peerreviewed = {Yes},
title = {{Comment} on “exposure to microplastics (<10 μm) associated to plastic bottles mineral water consumption: {The} first quantitative study by {Zuccarello} et al. [{Water} {Research} 157 (2019) 365–371]”},
year = {2019}
}
@article{faucris.245134760,
author = {Busse, Kristin and Ebner, Ingo and Humpf, Hans Ulrich and Ivleva, Natalia and Kaeppler, Andrea and Oßmann, Barbara and Schymanski, Darena},
doi = {10.1021/acs.est.0c03182},
faupublication = {yes},
journal = {Environmental Science & Technology},
note = {CRIS-Team Scopus Importer:2020-11-13},
pages = {14134-14135},
peerreviewed = {No},
title = {{Comment} on "{Plastic} {Teabags} {Release} {Billions} of {Microparticles} and {Nanoparticles} into {Tea}"},
volume = {54},
year = {2020}
}
@article{faucris.107206484,
abstract = {A CoMFA study was undertaken to elucidate the correlation of biological activity and structural parameters of 25 dopamine D4 antagonists. A special point of interest is that we have included the atypical D4 antagonist clozapine as a structural template for all other compounds. After comparing potential protonation sites at semiempirical (AM1) and ab initio (6-31G(d)) levels of theory, possible conformations of the lead compound 3-[4-(4-chlorophenyl)piperazin-1-ylmethyl]pyrazolo[1,5-a]pyridine (FAUC 113) were investigated by systematic semiempirical conformational analysis. The final conformation of FAUC 113, which was used as a template for the other compounds in the dataset, was chosen by clustering and rigid body alignment of all conformations to clozapine. The CoMFA applied on the final alignment resulted in a q2cv of 0.739. To elucidate the influence of the absolute orientation of the molecules within the grid space, the entire dataset was systematically rotated (1296 steps) within the lattice. The Gaussian-shaped distribution of the q2cv values spanned the range of 0.699-0.794 and therefore supports the significance of the analysis.},
author = {Lanig, Harald and Utz, Wolfgang and Gmeiner, Peter},
doi = {10.1021/jm001055e},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
pages = {1151-7},
peerreviewed = {Yes},
title = {{Comparative} molecular field analysis of dopamine {D4} receptor antagonists including 3-[4-(4-chlorophenyl)piperazin-1-ylmethyl]pyrazolo[1,5-a]pyridine ({FAUC} 113), 3-[4-(4-chlorophenyl)piperazin-1-ylmethyl]-{1H}-pyrrolo-[2,3-b]pyridine ({L}-745,870), and clozapine.},
volume = {44},
year = {2001}
}
@article{faucris.119774864,
author = {Lanig, Harald and Utz, Wolfgang and Gmeiner, Peter and Lanig, Harald},
doi = {10.1021/jm001055e},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
note = {UnivIS-Import:2015-03-09:Pub.2001.nat.dchph.lphch.compar},
pages = {1151-1157},
peerreviewed = {Yes},
title = {{Comparative} {Molecular} {Field} {Analysis} of {Dopamine} {D4} {Receptor} {Antagonists} {Including} 3-[4-(4-{Chlorophenyl})piperazin-1-ylmethyl]pyrazolo[1,5-a]pyridine ({FAUC} 113), 3-[4-(4-{Chlorophenyl})piperazin-1-ylmethyl]-{1H}-pyrrolo[2,3-b]pyridine ({L}-745,870), and {Clozapine}},
volume = {44},
year = {2001}
}
@article{faucris.122262624,
abstract = {Nonenzymatic post-translational protein modifications (nePTMs) result in changes of the protein structure that may severely influence physiological and technological protein functions. In the present study, ultrahigh-performance liquid chromatography-electrospray ionization tandem mass spectrometry (UHPLC-ESI-MS/MS) was applied for the systematic identification and site-specific analysis of nePTMs of β-lactoglobulin in processed milk. For this purpose, β-lactoglobulin, which had been heated with lactose under conditions to force nePTM formation (7 d/60 C), was screened for predicted modifications by using full scans and enhanced resolution scan experiments combined with enhanced product ion scans. Thus, the main glycation, glycoxidation, oxidation, and deamidation products of lysine, arginine, methionine, cysteine, tryptophan, and asparagine, as well as the N-terminus, were identified. Using these MS data, a very sensitive scheduled multiple reaction monitoring method suitable for the analysis of milk products was developed. Consequently, 14 different PTM structures on 25 binding sites of β-lactoglobulin were detected in different milk products. © 2013 American Chemical Society.},
author = {Meltretter, Jasmin and Wüst, Johannes and Pischetsrieder, Monika},
doi = {10.1021/jf401549j},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {β-lactoglobulin; glycation; mass spectrometry; oxidation; processed milk; protein modification},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.compre},
pages = {6971-6981},
peerreviewed = {Yes},
title = {{Comprehensive} analysis of nonenzymatic post-translational beta-lactoglobulin modifications in processed milk by ultrahigh-performance liquid chromatography-tandem mass spectrometry},
url = {http://pubs.acs.org/articlesonrequest/AOR-gkwvWiD9kpAAJzuZtpnp},
volume = {61},
year = {2013}
}
@article{faucris.314583180,
abstract = {The present study aimed to identify endogenous milk peptides for species differentiation independent of heat exposure. Thus, comprehensive milk peptide profiles from five species and three types of heat treatments were analyzed by micro-flow liquid chromatography ion mobility quadrupole time-of-flight mass spectrometry (microLC-IM-QTOF) with subsequent database search leading to ≥ 3000 identified peptides. In the milks, 1154 peptides were unique for cow, 712 for sheep, 466 for goat, 197 for buffalo, and 69 for mare. Most peptides were detected in extended-shelf life (ESL) milk (2010), followed by ultra-high temperature (UHT) processed (1474) and pasteurized milk (1459 peptides), with 693 peptides present in all milk types. A blind test set of 64 samples confirmed eight species-specific, but heat-independent marker peptides in milk from cow, seven from goat, six from sheep, nine from buffalo, and three from mare. The generated peptide profiles can also be used to identify species- and heat-specific markers.},
author = {Zenk, Nora and Laumer, Franziska and Dalabasmaz, Sevim and Stützer, Joachim and Mauser, Andreas and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2023.137973},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Endogenous peptide profiling; Mammalian milk; Marker peptide; microLC-QTOF-MS/MS; Milk heat treatment; Species specification},
note = {CRIS-Team Scopus Importer:2023-12-01},
peerreviewed = {Yes},
title = {{Comprehensive} species- and processing-specific peptide profiling of pasteurized, extended shelf-life and ultra-high temperature milk from cow, goat, sheep, buffalo, and mare},
volume = {438},
year = {2024}
}
@article{faucris.121011264,
abstract = {Maillard products, such as Nε-carboxymethyllysine (CML), are readily formed during the manufacturing of infant formulas. Little has been known, however, about the presence of CML in human breast milk and about the uptake of CML by infants. In this study, CML was measured in the serum and breast milk of 32 healthy mothers by ELISA. CML concentrations in breast milk (137 ± 82.7 ng/mL) were significantly lower than in the serum (399 ± 67.8 ng/mL, p < 0.001) and on average 35-fold lower than in infant formulas (4754 ± 4299.5 ng/mL). CML was also measured in the urine of 21 infants, which were fed with breast milk or formulas. Although there was a tendency toward higher urinary CML excretion in infants fed with hypoallergenic formulas compared to breast-fed ones, the differences were not significant. Neonates that were delivered by vaginal birth had significantly higher concentrations of CML compared to those delivered by caesarean section (1306 ± 653 vs 601 ± 220 ng/mL, p = 0.012). It is conclued that CML passes from the serum into the breast milk, but the levels are by far lower than in infant formulas. In very young neonates (≤3 days), the mode of delivery has a greater influence on urinary CML excretion than the nutrition. © 2006 American Chemical Society.},
author = {Dittrich, Ralf and Hoffmann, Inge and Stahl, Peter and Müller, Andreas and Beckmann, Matthias and Pischetsrieder, Monika},
doi = {10.1021/jf060905h},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Advanced glycation end-products; Breast milk; Infant formulas; Maillard products; N; Newborn; Urine},
note = {UnivIS-Import:2015-04-14:Pub.2006.nat.dchph.llmch.concen},
pages = {6924-6928},
peerreviewed = {Yes},
title = {{Concentrations} of {N} epsilon-{Carboxymethyllysine} in {Human} {Breast} {Milk}, {Infant} {Formulas}, and {Urine} of {Infants}},
url = {http://pubs.acs.org/cgi-bin/download.pl?jf060905h/C4tL},
volume = {54},
year = {2006}
}
@article{faucris.118874404,
abstract = {To evaluate nonaromatic catechol bioisosteres, the conformationally restrained enynes I and enediynes 2 were synthesized via palladium-catalyzed coupling as the key reaction step. Subsequent receptor binding studies at the dopamine receptor subtypes D1, D(2 long), D(2 short), D3, and D4 showed highly interesting binding profiles for the enynes 1a and lb when compared to dopamine. At the guanine nucleotide-sensitive high-affinity binding site of the D3 receptor, the target compound 1b (K(i) = 5.2 nM) was 10-fold more potent than dopamine but less potent at the D2 and D4 subtypes. In contrast to dopamine the agonists 1a and lb showed strong selectivity for the receptors of the D2 family (D2-D4). As far as we know, this study represents the first report on nonaromatic dopamine agonists. Comparison of molecular electrostatic potentials, derived from semiempirical molecular orbital calculations, and lipophilicity maps was performed.},
author = {Utz, Wolfgang and Gmeiner, Peter and Hübner, Harald and et al.},
author_hint = {Hübner Harald, Haubmann Christian, Utz Wolfgang, Gmeiner Peter},
doi = {10.1021/jm991098z},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
note = {UnivIS-Import:2015-03-06:Pub.2000.nat.dchph.lphch.conjug},
pages = {756-762},
peerreviewed = {Yes},
support_note = {Author relations incomplete. You may find additional data in field 'author{\_}hint'},
title = {{Conjugated} {Enynes} as {Nonaromatic} {Catechol} {Bioisosteres}: {Synthesis}, {Binding} {Experiments} and {Computational} {Studies} of {Novel} {Dopamine} {Receptor} {Agonists} {Recognizing} {Preferentially} the {D3} {Subtype}},
volume = {43},
year = {2000}
}
@article{faucris.291577604,
abstract = {The original version of this article contained a mistake. The authors noticed that one document, the co-author agreement, was also published as supplementary information. This document contains email correspondence for the agreement of including an additional co-author but is not a document related to the manuscript. The authors therefore want to remove this document from the SI since it is irrelevant for outside readers. The original article has been corrected.},
author = {Danyeli, Lena Vera and Sen, Zümrüt Duygu and Colic, Lejla and Kurzweil, Lisa and Gensberger-Reigl, Sabrina and Macharadze, Tamar and Götting, Florian and Refisch, Alexander and Liebe, Thomas and Chand, Tara and Kretzschmar, Moritz and Wagner, Gerd and Opel, Nils and Jollant, Fabrice and Speck, Oliver and Munk, Matthias H.J. and Li, Meng and Walter, Martin},
doi = {10.1038/s41398-023-02377-7},
faupublication = {yes},
journal = {Translational Psychiatry},
note = {CRIS-Team Scopus Importer:2023-03-10},
peerreviewed = {Yes},
title = {{Correction}: {Association} of the delayed changes in glutamate levels and functional connectivity with the immediate network effects of {S}-ketamine ({Translational} {Psychiatry}, (2023), 13, 1, (60), 10.1038/s41398-023-02346-0)},
volume = {13},
year = {2023}
}
@article{faucris.241521729,
abstract = {Microplastics (MPs) have been reported in various environmental compartments and their number is continuously increasing because of degradation into smaller fragments down to nanoplastics. Humans are exposed to these small-sized MPs through food and air with potential health consequences that still need to be determined. This requires, in the first place, efficient and detailed visualization, relocalization, and characterization of the same MPs with complementary analytical methods. Here, we show the first application of a correlative microscopy and spectroscopy workflow to MPs that meets these demands. For this purpose, standard MP particles on aluminum-coated polycarbonate membrane filters were investigated by an optical zoom microscope and a hyphenated scanning electron microscopy (SEM)-Raman system. By merging the obtained data in one software, it is possible to navigate on the entire filters’ surface and correlate at identical locations MP morphology at the spatial resolutions of electron (1.6 nm at 1 kV for the used SEM, ∼100 nm minimum MP size in this study) and optical (∼1–10 µm) microscopies with chemical identification by micro-Raman spectroscopy. Moreover, we observed that low-voltage SEM works without a conductive coating of MPs, causes no detectable charging and structural changes, and provides high-resolution surface imaging of single and clustered MP particles, thus enabling subsequent Raman measurements. We believe that further work on the accurate identification and quantification of micro- and nanoplastics in real samples can potentially profit from this workflow.},
author = {Sarau, George and Kling, Lasse and Oßmann, Barbara and Unger, Ann Katrin and Vogler, Frank and Christiansen, Silke H.},
doi = {10.1177/0003702820916250},
faupublication = {yes},
journal = {Applied spectroscopy},
keywords = {correlative workflow; Microplastic; microscopy; nanoplastic; Raman; scanning electron microscopy; SEM; spectroscopy},
note = {CRIS-Team Scopus Importer:2020-08-14},
peerreviewed = {unknown},
title = {{Correlative} {Microscopy} and {Spectroscopy} {Workflow} for {Microplastics}},
year = {2020}
}
@article{faucris.230226913,
abstract = {A new vitamin E homologue, α-tocomonoenol
was detected in palm oil, but was not isolated in large amounts and
with high purity so far. Here we present an easy and fast method to
isolate α-tocomonoenol from vitamin E rich nutrient capsules with
countercurrent chromatography (CCC). With the solvent system n-hexane – benzotrifluoride – acetonitrile (10:3.5:6.5, v/v/v)
about 30 mg α-tocomonoenol with a purity of 75% could be enriched in
one step from 1 g crude sample. Column chromatography with 20%
deactivated silica gel and n-hexane – ethyl acetate (95:5, v/v) was performed to gain 5.6 mg α-tocomonoenol with a purity of 99.5% according to GC/MS. Structural verification by 1H
NMR spectroscopy verified that the double bond was located in
11′-position (11′-α-tocomonoenol). The trace impurity detected in the
isolate was identified to be 12′-α-tocomonoenol, a compound previously
detected in marine samples.
},
author = {Müller, Marco and Hammann, Simon and Vetter, Walter},
doi = {10.1016/j.foodchem.2018.02.133},
faupublication = {no},
journal = {Food Chemistry},
keywords = {NMR spectroscopy; Palm Oil; Countercurrent chromatography; GC/MS; Tocomonoenol; Vitamin E},
pages = {327-332},
peerreviewed = {Yes},
title = {{Countercurrent} chromatographic isolation and purification of 11′-α-tocomonoenol from the vitamin {E} extract of palm oil},
url = {https://www.sciencedirect.com/science/article/pii/S0308814618303819},
volume = {256},
year = {2018}
}
@article{faucris.268450031,
abstract = {The usage of antigen-functionalized nanoparticles has become a major focus in the field of experimental HIV-1 vaccine research during the last decade. Various molecular mechanisms to couple native-like trimers of the HIV-1 envelope protein (Env) onto nanoparticle surfaces have been reported, but many come with disadvantages regarding the coupling efficiency and stability. In this study, a short amino acid sequence (“aldehyde-tag”) was introduced at the C-terminus of a conformationally stabilized native-like Env. The post-translational conversion of a tag-associated cysteine to formylglycine creates a site-specific aldehyde group without alteration of the Env antigenicity. This aldehyde group was further utilized for bioconjugation of Env trimers. We demonstrated that the low acidic environment necessary for this bioconjugation is not affecting the trimer conformation. Furthermore, we developed a two-step coupling method for pH-sensitive nanoparticles. To this end, we conjugated aldehyde-tagged Env with Propargyl-PEG3-aminooxy linker (oxime ligation; Step-one) and coupled these conjugates by copper-catalyzed azide-alkyne cycloaddition (Click reaction; Step-two) to calcium phosphate nanoparticles (CaPs) functionalized with terminal azide groups. CaPs displaying orthogonally arranged Env trimers on their surface (o-CaPs) were superior in activation of Env-specific B-cells (in vitro) and induction of Env-specific antibody responses (in vivo) compared to CaPs with Env trimers coupled in a randomly oriented manner. Taken together, we present a reliable method for the site-specific, covalent coupling of HIV-1 Env native-like trimers to the surface of nanoparticle delivery systems. This method can be broadly applied for functionalization of nanoparticle platforms with conformationally stabilized candidate antigens for both vaccination and diagnostic approaches. Statement of significance: During the last decade antigen-functionalized nanoparticles have become a major focus in the field of experimental HIV-1 vaccines. Rational design led to the production of conformationally stabilized HIV-1 envelope protein (Env) trimers - the only target for the humoral immune system. Various molecular mechanisms to couple Env trimers onto nanoparticle surfaces have been reported, but many come with disadvantages regarding the coupling efficiency and stability. In this paper, we describe a highly selective bio-conjugation of Env trimers to the surface of medically relevant calcium phosphate nanoparticles. This method maintains the native-like protein conformation and has a broad potential application in functionalization of nanoparticle platforms with stabilized candidate antigens (including stabilized spike proteins of coronaviruses) for both vaccination and diagnostic approaches.},
author = {Damm, Dominik and Kostka, K. and Weingärtner, Christoph and Wagner, Jannik and Rojas-Sánchez, L. and Gensberger-Reigl, Sabrina and Sokolova, V. and Überla, Klaus and Epple, M. and Temchura, Vladimir},
doi = {10.1016/j.actbio.2021.12.022},
faupublication = {yes},
journal = {Acta Biomaterialia},
keywords = {Aldehyde-tag; Calcium phosphate nanoparticles; HIV-1 Env native-like trimers; Orthogonal; Site-specific coupling; Surface conjugation},
note = {CRIS-Team Scopus Importer:2022-01-28},
peerreviewed = {Yes},
title = {{Covalent} coupling of {HIV}-1 glycoprotein trimers to biodegradable calcium phosphate nanoparticles via genetically encoded aldehyde-tags},
year = {2022}
}
@article{faucris.243308641,
abstract = {Microplastics are of major concerns for society and is currently in the focus of legislators and administrations. A small number of measures to reduce or remove primary sources of microplastics to the environment are currently coming into effect. At the moment, they have not yet tackled important topics such as food safety. However, recent developments such as the 2018 bill in California are requesting the analysis of microplastics in drinking water by standardized operational protocols. Administrations and analytical labs are facing an emerging field of methods for sampling, extraction, and analysis of microplastics, which complicate the establishment of standardized operational protocols. In this review, the state of the currently applied identification and quantification tools for microplastics are evaluated providing a harmonized guideline for future standardized operational protocols to cover these types of bills. The main focus is on the naked eye detection, general optical microscopy, the application of dye staining, flow cytometry, Fourier transform infrared spectroscopy (FT-Ir) and microscopy, Raman spectroscopy and microscopy, thermal degradation by pyrolysis–gas chromatography–mass spectrometry (py-GC-MS) as well as thermo-extraction and desorption gas chromatography–mass spectrometry (TED-GC-MS). Additional techniques are highlighted as well as the combined application of the analytical techniques suggested. An outlook is given on the emerging aspect of nanoplastic analysis. In all cases, the methods were screened for limitations, field work abilities and, if possible, estimated costs and summarized into a recommendation for a workflow covering the demands of society, legislation, and administration in cost efficient but still detailed manner.},
author = {Primpke, Sebastian and Christiansen, Silke H. and Cowger, Win and De Frond, Hannah and Deshpande, Ashok and Fischer, Marten and Holland, Erika B. and Meyns, Michaela and O'Donnell, Bridget A. and Oßmann, Barbara and Pittroff, Marco and Sarau, George and Scholz-Böttcher, Barbara M. and Wiggin, Kara J.},
doi = {10.1177/0003702820921465},
faupublication = {yes},
journal = {Applied Spectroscopy},
keywords = {Fourier transform infrared spectroscopy; FT-IR; guideline; harmonization; microplastic; microscopy; nanoplastic; py-GC-MS; pyrolysis–gas chromatography–mass spectroscopy; Raman; Regulation; visually},
note = {CRIS-Team Scopus Importer:2020-10-02},
pages = {1012-1047},
peerreviewed = {Yes},
title = {{Critical} {Assessment} of {Analytical} {Methods} for the {Harmonized} and {Cost}-{Efficient} {Analysis} of {Microplastics}},
volume = {74},
year = {2020}
}
@article{faucris.121304084,
abstract = {The reaction of reactive carbonyl compounds (RCCs) with lysine and arginine (Maillard reaction) is a common modification of proteins in thermally processed foods. In this study, the toxicity of Maillard reaction products (MRPs) formed from defined amino acids or dipeptides (bound to a cellulose membrane) with ribose, glycerinaldehyde or methylglyoxal was investigated. Murine RAW 264.7 macrophages were cultivated on the cellulose membrane and the effect of MRPs on cell viability was determined. The toxicity of MRPs was dependent on the RCC used and increased in the order of ribose < glycerinaldehyde < methylglyoxal. The dipeptides were more cytotoxic than the amino acids, with Lys-Lys MRPs being the most toxic of all tested MRPs. Cell numbers did not fall below the starting point, indicating that the MRPs rather inhibited proliferation than actually caused cell death. To develop an assay, in which whole membranes with multiple peptide spots could be tested simultaneously, we measured cell numbers on larger cellulose membranes using image analysis of the intracellularly formed formazan crystals. Although this method was technically feasable, it appears that uneven cell attachment on the membrane would require a way to detemine starting cell number by a non-destructive assay to yield more robust data. © 2009 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.},
author = {Muscat, Sonja and Pischetsrieder, Monika and Maczurek, Annette and Rothemund, Sven and Münch, Gerald},
doi = {10.1002/mnfr.200800366},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Cell viability; Glycation; Maillard products; Peptide library; Proliferation},
note = {UnivIS-Import:2015-03-09:Pub.2009.nat.dchph.llmch.cytoto},
pages = {1019-1029},
peerreviewed = {Yes},
title = {{Cytotoxicity} of {Maillard} reaction products determined with a peptide spot library},
volume = {53},
year = {2009}
}
@article{faucris.271367937,
abstract = {Reactive glucose degradation products (GDPs) are formed during heat sterilization of glucose-containing peritoneal dialysis fluids (PDFs) and may induce adverse clinical effects. Long periods of storage and/or transport of PDFs before use may lead to de novo formation or degradation of GDPs. Therefore, the present study quantified the GDP profiles of single- and double-chamber PDFs during storage. Glucosone, 3-deoxyglucosone (3-DG), 3-deoxygalactosone (3-DGal), 3,4-dideoxyglucosone-3-ene (3,4-DGE), glyoxal, methylglyoxal (MGO), acetaldehyde, formaldehyde, and 5-hydroxymethylfurfural (5-HMF) were quantified by two validated UHPLC-DAD methods after derivatization with o-phenylenediamine (dicarbonyls) or 2,4-dinitrophenylhydrazine (monocarbonyls). The PDFs were stored at 50 °C for 0, 1, 2, 4, 13, and 26 weeks. The total GDP concentration of single-chamber PDFs did not change considerably during storage (496.6 ± 16.0 µM, 0 weeks; 519.1 ± 13.1 µM, 26 weeks), but individual GDPs were affected differently. 3-DG (− 82.6 µM) and 3-DGal (− 71.3 µM) were degraded, whereas 5-HMF (+ 161.7 µM), glyoxal (+ 32.2 µM), and formaldehyde (+ 12.4 µM) accumulated between 0 and 26 weeks. Acetaldehyde, glucosone, MGO, and 3,4-DGE showed time-dependent formation and degradation. The GDP concentrations in double-chamber fluids were generally lower and differently affected by storage. In conclusion, the changes of GDP concentrations during storage should be considered for the evaluation of clinical effects of PDFs.},
author = {Gensberger-Reigl, Sabrina and Weigel, Ingrid and Stützer, Joachim and Auditore, Andrea and Nikolaus, Tim and Pischetsrieder, Monika},
doi = {10.1038/s41598-022-08123-1},
faupublication = {yes},
journal = {Scientific Reports},
note = {CRIS-Team Scopus Importer:2022-03-25},
peerreviewed = {Yes},
title = {{Degradation} and de novo formation of nine major glucose degradation products during storage of peritoneal dialysis fluids},
volume = {12},
year = {2022}
}
@article{faucris.211629028,
abstract = {This study
designed a prediction model to differentiate pasteurized milk from heated
extended shelf life (ESL) milk based on milk peptides. For this purpose,
quantitative peptide profiles of a training set of commercial samples including
pasteurized (n=20), pasteurized-ESL (n=13) and heated-ESL (n=16) milk were
recorded by MALDI-TOF-MS. Seven peptides were
selected as putative markers, and
cutoff levels and performance measures of each marker were defined by ROC analysis. The accuracy of these peptides in the
training set ranged between 71 and 90%. A prediction model was established based
on the combined cutoff levels and evaluated by an independent blind test set. The processing method of 19 out of 20
unknown milk samples was predicted correctly achieving 95% accuracy. Five peptides of the prediction model were
identified as αS1-casein182-199 (m/z 2014.0), αS1-casein180-199 (m/z 2216.1), αS1-casein1-24 (m/z 2910.6), β-casein108-125 (m/z 2126.0), and β-casein106-125 (m/z 2391.2) indicating thermal release and the action of
plasmin and cathepsins. Thus, the present study demonstrated that the milk
peptide profile reflects even minor differences in production parameter},
author = {Dalabasmaz, Sevim and Pischetsrieder, Monika},
doi = {10.1002/pmic.201800292},
faupublication = {yes},
journal = {Proteomics},
pages = {e1800292},
peerreviewed = {Yes},
title = {{Design} of a {Prediction} {Model} for the {Differentiation} of {Pasteurized} {Milk} from {Heated} {ESL} {Milk} by {Peptide} {Profiling}.},
volume = {19},
year = {2019}
}
@article{faucris.230227271,
abstract = {Furan fatty acids (F-acids) are valuable,
bioactive minor components in lipids which are characterized by a furan
moiety in the acyl chain. Here, we present a gas chromatography/mass
spectrometry method operated in the selected ion monitoring mode
(GC/MS-SIM) for the thorough determination of F-acid as methyl esters in
fish. The method takes advantage of the molecular ion and two
characteristic fragment ions and enables the unequivocal detection of
>350 saturated, mono- and dienoic F-acids in four GC/MS-SIM runs.
This method was applied to the analysis of the methyl esters obtained
from the triacylglyceride (TG) and the cholesteryl ester (CE) fraction
of ten individual fish liver samples. Up to 23 F-acids, including
several new or scarcely detected homologues, were detected in the
samples. The concentrations of total F-acids ranged from 25 to
280 mg/100 g lipids in the TG fractions and <0.11 to 115 mg/100 g
lipids in the CE fraction},
author = {Wendlinger, Christine and Hammann, Simon and Vetter, Walter},
doi = {10.1007/s12161-015-0211-x},
faupublication = {no},
journal = {Food Analytical Methods},
keywords = {Selectedionmonitoring; Furan fatty acids; Fish liver; Massspectrometry; Gas chromatography},
pages = {459-468},
peerreviewed = {Yes},
title = {{Detailed} study of furan fatty acids in total lipids and the cholesteryl ester fraction of fish liver},
url = {https://link.springer.com/article/10.1007/s12161-015-0211-x},
volume = {9},
year = {2016}
}
@article{faucris.116625124,
abstract = {Bovine spongiform encephalopathy (BSE) is most likely transmitted by the consumption of central nervous system (CNS) tissue of infected animals. In this study, an immunochemical assay for CNS in meat and meat products was developed using an antibody against Myelin proteolipid protein (PLP), which is very specifically expressed in the CNS. Solvent extraction of CNS-contaminated meat yielded a highly enriched PLP fraction. Subsequent Western blot analysis specifically detected the PLP band at 29 kDa. The detection limit for unprocessed CNS in raw meat was less than 0.025% and the quantification limit was calculated to be 0.049%. The PLP epitope was relatively stable during storage at 5 °C or -21 °C and during heating at 75 °C and 95 °C. Amounts of 0.1% CNS could be reliably detected in cooked bologna type sausage, cooked liver sausage and fermented sausage. Thus, the new assay allows highly specific and sensitive determination of CNS contaminations in meat and meat products. © 2007 Elsevier Ltd. All rights reserved.},
author = {Sandmeier, Barbara and Bäuerlein, Rainer and Villmann, Carmen and Düthorn, Tina and Gareis, Manfred and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2007.01.071},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Bovine spongiform encephalopathy; Central nervous system; Myelin proteolipid protein; Solvent extraction; Western blot},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.detect},
pages = {871-878},
peerreviewed = {Yes},
title = {{Detection} of central nervous system tissue in meat and meat products with a newly developed immunoassay selective for {Myelin} proteolipid protein},
volume = {105},
year = {2007}
}
@article{faucris.111598124,
abstract = {Sugars and sugar degradation products are formed during food processing, but also endogenously in vivo. In vitro, nucleosides and DNA react readily with these carbonyl compounds during the formation of the two diastereomers of N 2-carboxyethyl-2′-deoxyguanosine (CEdGA,B), leading to a loss of DNA integrity. Only little is known about DNA glycation in vivo and about the influence of nutrition on CEdG formation. In this study, we developed a sensitive method to analyze DNA glycation by HPLC. For this purpose, immunoaffinity chromatography (IAC) using a polyclonal antibody against N 2-carboxyethylguanine (CEguanine) was coupled to HPLC-DAD. In some samples, peak identity was confirmed by LC-MS/MS. The recovery of CEguanine from the IAC columns was 52.5% = 3.6 (n = 4). Thus, it was possible for the first time to detect CEdGA,B, N2-carboxyethylguanosine (CEG A,B), and CEguanine in 11 human urine samples. However, due to imprecision of IAC, valid quantification of the adducts could not be achieved. Furthermore, CEdG was also detected in the DNA of cultured human smooth muscle cells (SMCs) and bovine aorta endothelium cells (BAECs). In BAECs, CEdG A,B were found by HPLC-DAD and LC-MS/MS after immunoaffinity purification, whereas in SMCs DNA-advanced glycation end-products were only detected with the more sensitive LC-MS/MS method. © 2006 Wiley-VCH Verlag GmbH & Co. KGaA.},
author = {Schneider, Marc and Georgescu, Adriana and Bidmon, Clemens and Tutsch, Martin and Fleischmann, Erwin and Popov, Doina and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200500217},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Advanced glycation end-products; DNA; Immunoaffinity chromatography; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2006.nat.dchph.llmch.detect},
pages = {424-429},
peerreviewed = {Yes},
title = {{Detection} of {DNA}-bound advanced glycation end-products by immunoaffinity chromatography coupled to {HPLC}-diode array detection},
volume = {50},
year = {2006}
}
@article{faucris.120724384,
abstract = {Dideoxyosones (DDOs) are intermediates in the synthesis of advanced glycation endproducts (AGEs), such as pentosidine and glucosepane. Although the formation of pentosidine and glucosepane in the human lens has been firmly established, the formation of DDOs has not been demonstrated. The aim of this study was to develop a reliable method to detect DDOs in lens proteins. A specific DDO trapping agent, biotinyl-diaminobenzene (3,4-diamino-N-(3-[5-(2- oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanoyl]aminopropyl)benzamide) (BDAB) was added during in vitro protein glycation or during protein extraction from human lenses. In vitro glycated human lens protein showed strong reaction in monomeric and polymeric crosslinked proteins by Western blot and ELISA. Glycation of BSA in the presence of BDAB resulted in covalent binding of BDAB to the protein and inhibited pentosidine formation. Mass spectrometric analysis of lysozyme glycated in the presence of BDAB showed the presence of quinoxalines at lysine residues at positions K1, K33, K96, and K116. The ELISA results indicated that cataractous lens proteins contain significantly higher levels of DDO than non-cataractous lenses (101.9 ± 67.8 vs. 31.7 ± 19.5 AU/mg protein, p < 0.0001). This study provides first direct evidence of DDO presence in human tissue proteins and establishes that AGE crosslink synthesis in the human lens occurs via DDO intermediates. © 2011 Elsevier Inc. All rights reserved.},
author = {Linetsky, Mikhail and Johar, S.R. Kaid and Meltretter, Jasmin and Padmanabha, Smitha and Parmar, Trilok and Vasavada, Abhay R. and Pischetsrieder, Monika and Nagaraj, Ram H.},
doi = {10.1016/j.abb.2011.07.012},
faupublication = {yes},
journal = {Archives of Biochemistry and Biophysics},
keywords = {Advanced glycation endproducts; Cataract; Dideoxyosones; Glycation; Human lens proteins},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.determ},
pages = {16-26},
peerreviewed = {Yes},
title = {{Determination} of dideoxyosone precursors of {AGEs} in human lens proteins},
volume = {514},
year = {2011}
}
@article{faucris.111180784,
abstract = {Sugars and sugar degradation products react in vivo readily with proteins (glycation) resulting in the formation of a heterogeneous group of reaction products, which are called advanced glycation end products (AGEs). AGEs notably change the structure and function of proteins so that extended protein-AGE formation is linked to complications such as nephropathy, atherosclerosis, and cataract. DNA can be glycated in vitro in a similar way as proteins, and the two diastereomers of N2-carboxyethyl-2′-deoxyguanosine (CEdG A,B) were identified as major DNA AGEs. It was postulated that DNA AGEs play an important role in aging, diabetes, and uremia. However, at the moment, sensitive methods to measure the extent and impact of DNA AGEs in vivo do not exist. In this study, we developed a monoclonal antibody, which recognized CEdGA,B with high affinity and specificity (MAb M-5.1.6). The I50 value for CEdGA,B was 2.1 ng/mL, whereas other modified nuclueobases and AGE proteins showed negligible cross-reactivity. Unmodified 2′-deoxyguanosine was only weakly recognized with an I 50 value > 600 000 ng/mL, which is the limit of solubility. MAb M-5.1.6 was then used to measure the urinary excretion of AGE-modified nucleobases in a competitive enzyme-linked immunosorbent assay. The recovery of CEdGA,B from human urine was between 87.4 and 99.7% with coefficients of variations between 8.0 and 22.2%. The detection limit was 0.06 ng/mL, and the determination limit was 0.15 ng/mL with a linear range between 0.3 and 100 ng/mL. CEdG equivalents were analyzed in urine samples from 121 healthy volunteers, and concentrations between 1.2 and 117 ng CEdG equiv/mg creatinine were detected.},
author = {Schneider, Marc and Thoß, Gerlinde and Hübner-Parajsz, Christa and Kientsch-Engel, Rose and Stahl, Peter and Pischetsrieder, Monika},
doi = {10.1021/tx049929d},
faupublication = {yes},
journal = {Chemical Research in Toxicology},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.determ},
pages = {1385-1390},
peerreviewed = {Yes},
title = {{Determination} of {Glycated} {Nucleobases} in {Human} {Urine} by a {New} {Monoclonal} {Antibody} {Specific} for {N²}-{Carboxyethyl}-2'-deoxyguanosine},
url = {http://pubs.acs.org/cgi-bin/download.pl?tx049929d/Z5Pv},
volume = {17},
year = {2004}
}
@article{faucris.308450045,
abstract = {Cereals contain lipids that fulfill important physiological roles and are associated with stress in the plant. However, many of the specific biological roles of lipids are yet unknown. Comprehensive analysis of these polar lipid categories in whole grain wheat and oat, cereals highly relevant also in nutrition, was performed. Hydrophilic interaction liquid chromatography (HILIC) and reversed-phase high-performance liquid chromatography (RP-HPLC) coupled with high-resolution mass spectrometry using electrospray ionization in both positive and negative ionization mode was used. Exploiting the different separation mechanisms, HILIC was used as a screening method for straightforward lipid class assignment and enabled differentiation of isomeric lipid classes, like phosphatidylethanolamine and lyso-N-acylphosphatidylethanolamine, while RP-HPLC facilitated separation of constitutional isomers. In combination with data-dependent MS/MS experiments, 67 lipid species belonging to nine polar lipid classes could be identified. Furthermore, with both ionization modes, fatty acyl chains directly connected to the lipid headgroups could be assigned. This work focused on the four lipid classes N-acylphosphatidylethanolamines, acyl-monogalactosyldiacylglycerols, digalactosyldiacylglycerols, and monogalactosyldiacylglycerols as they were less studied in detail in the past. Applying the complementary approach, the relative lipid species compositions in these lipid classes was investigated in detail.
2 = 0.990. © 2009 American Chemical Society.},
author = {Schneider, Nadine and Weigel, Ingrid and Werkmeister, Knut and Pischetsrieder, Monika},
doi = {10.1021/jf9025019},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Allergen; Cheese; ELISA; Lysozyme; Monoclonal antibody},
note = {UnivIS-Import:2015-03-09:Pub.2010.nat.dchph.llmch.develo},
pages = {76-81},
peerreviewed = {Yes},
title = {{Development} and validation of an enzyme-linked immunosorbent assay ({ELISA}) for quantification of lysozyme in cheese},
url = {http://pubs.acs.org/articlesonrequest/AOR-ENXNz8kdwbn5ffxxscgD},
volume = {58},
year = {2010}
}
@article{faucris.115199084,
abstract = {A method was developed and validated to quantify 3,4-dideoxyglucosone-3-ene in peritoneal dialysis fluids by high-performance liquid chromatography with UV detection after derivatization with o-phenylenediamine. The advantages of this method compared with direct HPLC analysis are (i) the possibility of quantifying 3,4-dideoxyglucosone-3-ene simultaneously together with other glucose degradation products, (ii) the compatibility of the method with MS detection for unequivocal identification of the analyte and (iii) a bathochromic shift of the UV absorbance maximum which leads to higher selectivity. The validated method was used to measure 3,4-dideoxyglucosone-3-ene concentrations additionally to the glucose degradation products 3-deoxyglucosone, methylglyoxal, glyoxal, 5-hydroxymethylfurfural, 2-furaldehyde, formaldehyde and acetaldehyde in 19 commercial products for peritoneal dialysis. Copyright © 2009 John Wiley & Sons, Ltd.},
author = {Frischmann, Matthias and Spitzer, Johanna and Fünfrocken, Michael and Mittelmaier, Stefan and Deckert, Melanie and Fichert, Thomas and Pischetsrieder, Monika},
doi = {10.1002/bmc.1194},
faupublication = {yes},
journal = {Biomedical Chromatography},
keywords = {3,4-Dideoxyglucosone-3-ene (3,4-DGE); Glucose degradation products (GDP); HPLC; Peritoneal dialysis fluid (PD fluid)},
note = {UnivIS-Import:2015-04-14:Pub.2009.nat.dchph.llmch.develo},
pages = {843-851},
peerreviewed = {Yes},
title = {{Development} and validation of an {HPLC} method to quantify 3,4-dideoxyglucosone-3-ene in peritoneal dialysis fluids},
volume = {23},
year = {2009}
}
@article{faucris.121510664,
abstract = {As a potential transmitter of bovine spongiform encephalopathy (BSE), tissue from bovine central nervous system (CNS) is not accepted in meat and meat products. Western blot analysis of the CNS marker myelin proteolipid protein (PLP) detects CNS contamination selectively and sensitively. In this study, a rapid dot blot assay using an anti-PLP antibody was developed to screen CNS contamination of meat and contact surfaces. The detection limit was 0.01% bovine brain in minced bovine muscle. When applied to a swab test, down to 0.5 mg of CNS tissue on meat or other surfaces was detectable. Other offal tissues or peripheral nerves did not interfere with the assay. The test allows a differentiation between mammalian and avian CNS but not among mammalian species. The swab test was applied immediately after slaughtering at several areas of the bovine head. CNS was not detectable at any region which may enter the food chain. © 2008 American Chemical Society.},
author = {Bäuerlein, Rainer and Sandmeier, Barbara and Villmann, Carmen and Hammon, Antje and Gareis, Manfred and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1021/jf0718493},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Bovine spongiform encephalopathy; Central nervous system; Dot blot; Meat; Myelin proteolipid protein; PLP; Swab test},
note = {UnivIS-Import:2015-03-09:Pub.2008.nat.dchph.llmch.develo},
pages = {44-49},
peerreviewed = {Yes},
title = {{Development} of a {Dot} {Blot} {Assay} for the {Rapid} {Detection} of {Central} {Nervous} {System} {Tissue} on {Meat} and {Contact} {Surfaces}},
volume = {56},
year = {2008}
}
@article{faucris.114151224,
abstract = {Subtype-selective neurotensin receptor2 (NTS2) ligands can be used as molecular probes to investigate the physiological role of neurotensinergic systems and serve as lead compounds to initiate the development of drugs for the treatment of tonic pain. Starting from our recently described NTS2 ligand 1, structural variants of type 2 were synthesized to further improve binding affinity and selectivity to gain metabolic stability. The peptide-peptoid hybrid 2b showed excellent NTS2 binding affinity (K=2.8nM) and 22000-fold selectivity over NTS1, as well as metabolic stability over 32h in a serum degradation assay. Employing a MAPK-driven luciferase reporter gene assay and an IP accumulation assay, the neurotensin mimetic 2b displayed respective inhibitions of constitutive activity exceeding 4.3- and 3.9-fold that of the inverse agonist activity of the endogenous ligand neurotensin. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.},
author = {Held, Cornelia and Plomer, Manuel and Hübner, Harald and Meltretter, Jasmin and Pischetsrieder, Monika and Gmeiner, Peter},
doi = {10.1002/cmdc.201200376},
faupublication = {yes},
journal = {ChemMedChem},
pages = {75-81},
peerreviewed = {Yes},
title = {{Development} of a {Metabolically} {Stable} {Neurotensin} {Receptor} 2 ({NTS2}) {Ligand}},
volume = {8},
year = {2013}
}
@article{faucris.213267162,
abstract = {When analysing microplastics in food, due to toxicological reasons it is important to achieve clear identification of particles down to a size of at least 1~\textgreekmm. One reliable, optical analytical technique allowing this is micro-Raman spectroscopy. After isolation of particles via filtration, analysis is typically performed directly on the filter surface. In order to obtain high qualitative Raman spectra, the material of the membrane filters should not show any interference in terms of background and Raman signals during spectrum acquisition. To facilitate the usage of automatic particle detection, membrane filters should also show specific optical properties. In this work, beside eight different, commercially available membrane filters, three newly designed metal-coated polycarbonate membrane filters were tested to fulfil these requirements. We found that aluminium-coated polycarbonate membrane filters had ideal characteristics as a substrate for micro-Raman spectroscopy. Its spectrum shows no or minimal interference with particle spectra, depending on the laser wavelength. Furthermore, automatic particle detection can be applied when analysing the filter surface under dark-field illumination. With this new membrane filter, analytics free of interference of microplastics down to a size of 1~\textgreekmm becomes possible. Thus, an important size class of these contaminants can now be visualized and spectrally identified.},
author = {Oßmann, Barbara and Sarau, George and Schmitt, Sebastian W. and Holtmannspoetter, Heinrich and Christiansen, Silke H. and Dicke, Wilhelm},
doi = {10.1007/s00216-017-0358-y},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
note = {EAM Import::2019-03-13},
pages = {4099-4109},
peerreviewed = {unknown},
title = {{Development} of an optimal filter substrate for the identification of small microplastic particles in food by micro-{Raman} spectroscopy},
volume = {409},
year = {2017}
}
@article{faucris.230227646,
abstract = {Lipid compounds (fatty acids,
tocochromanols, phytosterols) are difficult to separate by
countercurrent chromatography (CCC) due to the existence of many similar
structures and the limited availability of suitable biphasic solvent
systems. Here we show that for these compound classes the success of a
CCC separation can be directly derived from the chemical structures
without the necessity of experimental determinations of K values. In
most cases, lipid compounds differ in the total carbon number and the
number of double bonds. For each structure the so-called equivalent
chain length (ECL) can be calculated by subtracting a distinct value for
each double bond from the total carbon number. Empirically, we verified
that in the case of unbranched fatty acids (determined as methyl
esters) one double bond corresponds with two carbons. Evaluation of CCC
data from seventeen phytosterols in five plant oils and nine
tocochromanol standards showed that one double bond was equal with one
carbon for both lipid classes. Most compounds with different ECL can be
separated by CCC but not those with the same ECL. In these cases, the
selection of a suitable source for isolation of a particular lipid
compound becomes very important. Knowledge of the impact of double bonds
may also be a helpful tool for other substance classes.
},
author = {Vetter, Walter and Müller, Marco and Sommer, Katrin and Schröder, Markus and Hammann, Simon},
doi = {10.1016/j.chroma.2019.04.042},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {fatty acids; phytosterols; Countercurrent chromatography; equivalent chain length rule; tocochromanols},
pages = {187-195},
peerreviewed = {Yes},
title = {{Development} of equivalent chain length ({ECL}) rules for lipid compounds},
url = {https://www.sciencedirect.com/science/article/pii/S0021967319304108},
volume = {1599},
year = {2019}
}
@article{faucris.232792019,
author = {Korf, Ansgar and Hammann, Simon and Schmid, Robin and Froning, Matti and Hayen, Heiko and Cramp, Lucy J.E.},
doi = {10.1038/s41598-019-57154-8},
faupublication = {yes},
journal = {Scientific Reports},
month = {Jan},
peerreviewed = {Yes},
title = {{Digging} deeper - {A} new data mining workflow for improved processing and interpretation of high resolution {GC}-{Q}-{TOF} {MS} data in archaeological research},
volume = {10},
year = {2020}
}
@article{faucris.230228024,
abstract = {Edible vegetable oils are an important part of the human diet.
Products with different levels of processing are marketed for this
purpose. Key‐products are virgin oils, refined oils, and partly or fully
hydrogenated oils. In this study we explored whether compounds derived
from trans‐phytol, i.e. the natural constituent of chlorophyll,
could serve as marker compounds for identifying the processing type of
oils, spreads and margarines. The evaluation was based on the
contribution of the native trans‐phytol along with its transformation products cis‐ and iso‐phytol
as well as dihydrophytol. Gas chromatography with mass spectrometry
operated in the selected ion monitoring mode enabled the detection of
these compounds at >0.01 mg/100 g oil or fat. In virgin vegetable
oils trans‐phytol was the principle phytol related compound while cis‐phytol was generally <0.05% and iso‐phytol and dihydrophytol were not detected at all. Refined vegetable oils contained trans‐, cis‐, and iso‐phytol
but no dihydrophytol. Partly and totally hydrogenated vegetable oils
contained dihydrophytol if at least 5% hydrogenated fat were present in
the oil. The occurrence of cis‐ and iso‐phytol in
vegetable oils can be used as indicators for refined oils while the
presence of dihydrophytol in vegetable oils is an indication for
hydrogenation.
Practical applications: The analysis of trans‐phytol, cis‐phytol, iso‐phytol, and dihydrophytol can be used in food control for oil authentication. In this context iso‐phytol
can serve as an additional marker for refined vegetable oils and
dihydrophytol as a marker for hydrogenated vegetable oils.},
author = {Schröder, Markus and Lehnert, Katja and Hammann, Simon and Vetter, Walter},
doi = {10.1002/ejlt.201400095},
faupublication = {no},
journal = {European Journal of Lipid Science and Technology},
keywords = {Dihydrophytol; Authentication; Phytol; Hydrogenated oils; Virgin oils; Refined oils},
pages = {1372-1380},
peerreviewed = {Yes},
title = {{Dihydrophytol} and phytol isomers as marker substances for hydrogenated and refined vegetable oils},
url = {https://onlinelibrary.wiley.com/doi/full/10.1002/ejlt.201400095},
volume = {116},
year = {2014}
}
@article{faucris.117433844,
abstract = {During thermal milk processing, severe oxidation can occur, which alters the technological and physiological properties of the milk proteins. Due to differences in composition and physicochemical properties, it can be expected that the particular milk proteins are differently affected by oxidative damage. Therefore, the protein-specific distribution of oxidation products in the heated milk proteome was investigated. Raw and heated milk samples were separated by one-dimensional gel electrophoresis. Protein oxidation was visualized by Western blot after derivatization of protein carbonyls with 2,4-dinitrophenylhydrazine. Thus, α-lactalbumin displayed enhanced oxidation compared to α-lactoglobulin, despite its lower concentration in milk. Highly selective oxidation was detected for a previously unassigned minor milk protein. The protein was identified by its peptide mass fingerprint as a variant of αS1-casein (αS1-casein*). Similar oxidation patterns were observed in several commercial milk products. © 2012 American Chemical Society.},
author = {Meyer, Bianca and Baum, Florian and Vollmer, Gregor and Pischetsrieder, Monika},
doi = {10.1021/jf301666r},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {aS1-casein; milk proteins; milk proteome; processed milk; protein carbonyls; protein oxidation},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.distri},
pages = {7306-7311},
peerreviewed = {Yes},
title = {{Distribution} of protein oxidation products in the proteome of thermally processed milk},
url = {http://pubs.acs.org/articlesonrequest/AOR-sGNK96F3UuWpRtBJq3zu},
volume = {60},
year = {2012}
}
@article{faucris.304995262,
abstract = {While phosphates are key additives in sausage production, their use conflicts with consumer preferences for “natural” foods. In this study, we investigated the potential of using vegetables as “clean-label” phosphate substitutes and their effects on water holding capacity, consumer acceptance, color, softness, and tenderness. Six freeze-dried vegetables with a pH above 6.0 were added to sausage meat on a laboratory scale. Adding 1.6% freeze-dried Brussels sprouts or Red Kuri squash resulted in a similar weight gain (7.0%) as the positive control of 0.6% commercial phosphate additive. Higher vegetable concentrations (2.2–4.0%) caused a significant increase in weight (p ≤ 0.05, 10.4–18.4% weight gain). Similar stress was needed to compress sausages containing 1.6/4.0% Brussels sprouts (14.2/11.2 kPa) and the positive control (13.2 kPa). Indentation tests also led to similar softness results for the sausages prepared with 1.6/4.0% Brussels sprouts (15.5 kPa/16.6 kPa) and the positive control (16.5 kPa). A force of 1.25 N was needed to shear the positive control, while 1.60 N/1.30 N was needed for the samples (1.6/4% Brussels sprouts). In summary, the present study indicates that freeze-dried vegetables have the potential to effectively replace phosphate in meat products.},
author = {Weigel, Ingrid and Nistler, Sarah and Pichner, Rohtraud and Budday, Silvia and Gensberger-Reigl, Sabrina},
doi = {10.3390/foods12101960},
faupublication = {yes},
journal = {Foods},
keywords = {clean-label; freeze-dried vegetables; meat products; phosphate; phosphate substitutes; sausages},
note = {CRIS-Team Scopus Importer:2023-06-09},
peerreviewed = {Yes},
title = {{Dried} {Vegetables} as {Potential} {Clean}-{Label} {Phosphate} {Substitutes} in {Cooked} {Sausage} {Meat}},
volume = {12},
year = {2023}
}
@article{faucris.111186944,
author = {Reznikov, Leonid and Waksman, Javier and Azam, Tania and Kim, Soo-Hyun and Bufler, Philip and Niwa, Toshimitsu and Werman, Ariel and Zhang, Xiaohong and Pischetsrieder, Monika and Shaldon, Stanley and Dinarello, Charles A.},
faupublication = {yes},
journal = {Clinical Nephrology},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.effect},
pages = {324-336},
peerreviewed = {Yes},
title = {{Effect} of advanced glycation end products on endotoxin-induced {TNF}-alpha, {IL}-1beta and {IL}-8 in human peripheral blood mononuclear cells},
volume = {61},
year = {2004}
}
@inproceedings{faucris.207736404,
author = {Denzer-Lippmann, Melanie and Bachlechner, S. and Wielopolski, Jan and Fischer, M. and Büttner, Andrea and Dörfler, Arnd and Schöfl, Christof and Münch, Gerald and Kornhuber, Johannes and Thürauf, Norbert},
faupublication = {yes},
note = {EVALuna2:33155},
pages = {410-411},
peerreviewed = {Yes},
title = {{Effect} of oral bolus versus sustained release application of nutrient solution on olfaction},
volume = {41},
year = {2016}
}
@article{faucris.120734504,
abstract = {Roasted carob powder was obtained using different time-temperature combinations and some quality characteristics such as total phenolic content (TPC), total antioxidant activity (TAA), browning index (BI) at 420 nm, UV absorbance (UV-A) at 294 nm, and pH has been investigated. Both the roasting temperature and time significantly (P < 0.01) affected the quality characteristics of the product. However, the roasting time was found to be a critical factor in determining the overall quality of the product. While the TPC, TAA, BI and UV-A values of the samples increased with the increasing roasting temperature and time, the pH of the samples decreased gradually. The quality characteristics of the carob powders changed markedly in between 20 and 60 min of roasting which indicates that the heat-induced reactions accelerate particularly in that period of roasting. The correlations between all these chemical properties of carob powder were found to be significant (P < 0.0001) during roasting. © Springer-Verlag 2009.},
author = {Sahin, Hilal and Topuz, Ayhan and Pischetsrieder, Monika and Feramuz, Özdemir},
doi = {10.1007/s00217-009-1152-7},
faupublication = {yes},
journal = {European Food Research and Technology},
keywords = {Antioxidant activity; Browning index; Carob powder; Maillard reaction; Roasting; Total phenolic},
note = {UnivIS-Import:2015-03-09:Pub.2009.nat.dchph.llmch.effect},
pages = {155-161},
peerreviewed = {Yes},
title = {{Effect} of roasting on phenolic, antioxidant and browning properties of carob powder},
volume = {230},
year = {2009}
}
@inproceedings{faucris.207736174,
author = {Thürauf, Norbert and Denzer-Lippmann, Melanie and Bachlechner, Stephan and Wielopolski, Jan and Fischer, Marie and Büttner, Andrea and Dörfler, Arnd and Schöfl, Christof and Münch, Gerald and Kornhuber, Johannes},
faupublication = {yes},
note = {EVALuna2:33148},
pages = {E55-E55},
peerreviewed = {Yes},
title = {{Effects} of different isocaloric oral nutrient solutions on olfactory functioning, hunger and food craving},
volume = {42},
year = {2017}
}
@article{faucris.313789668,
abstract = {In this study, the effects of gelatin concentrations (GC) (5.0–10.0 g/100 g), mixing rate (MR) (100–1100 rpm), and gelatin addition temperature (GAT) (55, 60, and 65°C) were investigated on the main textural and various physicochemical properties of model gels (n = 72) prepared using sucrose and glucose syrup (40–42 DE). Considering the p-value of the F-statistic calculated by analysis of variance and the 5% significance level, the production parameters and their interactions had a significant effect on the quality parameters. The influence of the production parameters GC, MR, and GAT, and the interaction of these parameters, GC * MR, GC * GAT, MR * GAT, and GC * MR * GAT of the model gels on the quality characteristic were expressed by converting the Type III SS values into percent values. When all quality characteristics were considered together, MR was the most influential with a score of 58%. PCAmix, a combination of factorial analysis with PCA, was used to visualize the correlations between the production parameters and the quality characteristics of the modeled gels. A great influence was observed between MR and moisture content, color properties, and texture parameters, except springiness. A moderate effect of GC and a minor effect of GAT could be characterized. With the 2D-map of observations, the model gels could be clearly divided into two groups according to the MRs. In accordance with the observations diagram of PCAmix, the similarity dendrogram of AHC also formed two clusters, one cluster for the samples with MR 100 and 200 rpm and one cluster for the samples with MR 500 and 1100 rpm.},
author = {Dalabasmaz, Sevim and Melayim, Mehmet Erhan and Konar, Nevzat},
doi = {10.1111/jtxs.12800},
faupublication = {yes},
journal = {Journal of Texture Studies},
keywords = {confectionery; gelatin; texture},
note = {CRIS-Team Scopus Importer:2023-11-10},
peerreviewed = {Yes},
title = {{Effects} of gelatin concentration, adding temperature and mixing rate on texture and quality characteristics of model gels},
year = {2023}
}
@article{faucris.287835641,
abstract = {Optimal conditions for formulation of cocoa butter substitute (CBS)-based milk chocolate produced in a ball mill with hydrogenated palm kernel oil stearin as CBS were defined using a D-optimal mixture design. In the formulation of chocolate samples, various amounts of whole milk powder, skimmed milk powder and demineralised whey powder were used and their effect on physico-chemical, colour, texture, and sensory properties were investigated. The fitted models demonstrated significant effects of independent variables on various quality parameters. Optimum formulation for selected parameters to maximise taste and minimise whole milk powder content as well as reduce costs were determined. Moreover, the optimum formulation was produced to validate the optimum model. Results of the validation were consistent with the findings of the model study. Furthermore, the approach used in this work could be employed to develop strategies to produce CBS-based milk chocolate with lower costs and various quality properties.},
author = {Konar, Nevzat and Polat, Derya Genc and Dalabasmaz, Sevim and Erdogan, Melih and Sener, Sinem and Sarıkaya, Ebru Kelleci},
doi = {10.1016/j.idairyj.2022.105571},
faupublication = {yes},
journal = {International Dairy Journal},
note = {CRIS-Team Scopus Importer:2023-01-20},
pages = {105571},
peerreviewed = {Yes},
title = {{Effects} of various milk powders on main quality parameters of cocoa butter substitute-based chocolate},
volume = {139},
year = {2023}
}
@article{faucris.112581084,
abstract = {The accumulation of somatic mutations in mitochondrial DNA (mtDNA) induced by reactive oxygen species (ROS) is regarded as a major contributor to aging and age-related degenerative diseases. ROS have also been shown to facilitate the formation of certain advanced glycation end-products (AGEs) in proteins and DNA and N 2-carboxyethyl-2′-deoxyguanosine (CEdG) has been identified as a major DNA-bound AGE. Therefore, the influence of mitochondrial ROS on the glycation of mtDNA was investigated in primary embryonic fibroblasts derived from mutant mice (Sod2 -/+) deficient in the mitochondrial antioxidant enzyme manganese superoxide dismutase. In Sod2 -/+ fibroblasts vs wild-type fibroblasts, the CEdG content of mtDNA was increased from 1.90 ± 1.39 to 17.14 ± 6.60 pg/μg DNA (p<0.001). On the other hand, the CEdG content of nuclear DNA did not differ between Sod2 +/+ and Sod2 -/+ cells. Similarly, cytosolic proteins did not show any difference in advanced glycation end-products or protein carbonyl contents between Sod2 +/+ and Sod2 -/+. Taken together, the data suggest that mitochondrial oxidative stress specifically promotes glycation of mtDNA and does not affect nuclear DNA or cytosolic proteins. Because DNA glycation can change DNA integrity and gene functions, glycation of mtDNA may play an important role in the decline of mitochondrial functions. © 2012 Elsevier Inc. All rights reserved.},
author = {Weigel, Ingrid and Pischetsrieder, Monika and Breyer, Viola and Huang, Ting-Ting},
doi = {10.1016/j.freeradbiomed.2012.02.021},
faupublication = {yes},
journal = {Free Radical Biology and Medicine},
keywords = {Advanced glycation end-products; N2-carboxyethyl-2′-deoxyguanosine; DNA glycation; Mitochondria; Mn superoxide dismutase; Mitochondrial DNA; Oxidative stress; Free radicals},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.endoge},
pages = {1744-1749},
peerreviewed = {Yes},
title = {{Endogenous} mitochondrial oxidative stress in {MnSOD} deficient mouse embryonic fibroblasts promotes mitochondrial {DNA} glycation},
volume = {52},
year = {2012}
}
@article{faucris.252114942,
abstract = {Scope: β-lactoglobulin (BLG) is a major cow milk allergen encountered by the immune system of infants fed with milk-based formulas. To determine the effect of processing on immunogenicity of BLG, this article characterized how heated and glycated BLG are recognized and internalized by APCs. Also, the effect of heat-induced structural changes as well as gastrointestinal digestion on immunogenicity of BLG is evaluated. Methods and results: The binding and uptake of BLG from raw cow milk and heated either alone (BLG-H) or with lactose/glucose (BLG-Lac and BLG-Glu) to the receptors present on APCs are analyzed by ELISA and cell-binding assays. Heated and glycated BLG is internalized via galectin-3 (Gal-3)and scavenger receptors (CD36 and SR-AI) while binding to the receptor for advanced glycation end products (R AGE) does not cause internalization. Receptor affinity of BLG is dependent on increased hydrophobicity, β-sheet exposure and aggregation. Digested glycated BLG maintained binding to sRAGE and Gal-3 but not to CD36 and SR-AI, and is detected on the surface of APCs. This suggests a mechanism via which digested glycated BLG may trigger innate (via RAGE) and adaptive immunity (via Gal-3). Conclusions: This study defines structural characteristics of heated and glycated BLG determining its interaction with APCs via specific receptors thus revealing enhanced immunogenicity of glycated versus heated BLG.},
author = {Teodorowicz, Malgorzata and Zenker, Hannah E. and Ewaz, Arifa and Tsallis, Theodoros and Mauser, Andreas and Gensberger-Reigl, Sabrina and de Jong, Nicolette W. and Hettinga, Kasper A. and Wichers, Harry J. and van Neerven, R. J.Joost and Savelkoul, Huub F.J.},
doi = {10.1002/mnfr.202000834},
faupublication = {yes},
journal = {Molecular nutrition & food research},
keywords = {aggregation of β-lactoglobulin; cow milk processing; digestion of β-lactoglobulin; galactin-3 Maillard reaction ligands; glycation of β-lactoglobulin; RAGE Maillard reaction ligands},
note = {CRIS-Team Scopus Importer:2021-03-19},
peerreviewed = {Yes},
title = {{Enhanced} {Uptake} of {Processed} {Bovine} β-{Lactoglobulin} by {Antigen} {Presenting} {Cells}: {Identification} of {Receptors} and {Implications} for {Allergenicity}},
year = {2021}
}
@article{faucris.230228456,
abstract = {
Mushrooms are a valued source of
sterols, which can be present in free form and esterified to fatty
acids. In addition to the principal ergosterol, several minor sterols
occur. Ergosterol and ergosteryl ester were determined directly by gas
chromatography coupled to mass spectrometry (GC/MS) in the
trimethylsilylated lipid extract of each six samples of button
mushrooms, oyster mushrooms, king trumpet mushrooms and shiitake. Free
ergosterol was highest in button mushrooms 415–544 mg/100 g dry matter (d.m.) and lowest in oyster and king trumpet mushrooms (<350 mg/100 g d.m.). On the other hand, concentrations of ergosteryl esters were significantly lower (5–26 mg/100 g
d.m.) in all mushroom samples. The distribution of minor sterols (most
importantly ergosta-7,22-dienol, ergosta-5,7-dienol, ergosta-7-enol)
between free and esterified form was determined after group separation
with solid phase extraction. Higher proportions of the minor sterols
were found esterified to fatty acids and ergosta-7-enol was found
predominantly (70%) in this form in oyster mushrooms and shiitake. The
minor sterols ergosta-8,24(241)-dienol, ergosta-8-enol and
7-dehydro-poriferasterol could be tentatively identified in the samples
based on GC/MS data. In addition, four sterols were found only in the
steryl ester fraction of the mushroom samples.
},
author = {Hammann, Simon and Lehnert, Katja and Vetter, Walter},
doi = {10.1016/j.jfca.2016.10.002},
faupublication = {no},
journal = {Journal of Food Composition and Analysis},
keywords = {Pleurotus ostreatus; Steryl ester; Basidiomycete; Agaricus bisporus; Gas chromatography; Ergosterol; Mass spectrometry; Lentinus edodes; Pleurotus eryngii; Mushroom},
pages = {48-54},
peerreviewed = {Yes},
title = {{Esterified} sterols and their contribution to the total sterols in edible mushrooms},
url = {https://www.sciencedirect.com/science/article/pii/S0889157516301752},
volume = {54},
year = {2016}
}
@article{faucris.123868404,
author = {Tanji, Nozomu and Markowitz, Glen and Fu, Caifeng and Kislinger, Thomas and Taguchi, Akihiko and Pischetsrieder, Monika and Stern, David M. and Schmidt, Ann Marie and D'Agati, Vivette},
faupublication = {yes},
journal = {Journal of the American Society of Nephrology},
note = {UnivIS-Import:2015-03-06:Pub.2000.nat.dchph.llmch.expres},
pages = {1656-1666},
peerreviewed = {Yes},
title = {{Expression} of advanced glycation end products and their cellular recptor {RAGE} in diabetic nephropathy and nondiabetic renal disease},
volume = {11},
year = {2000}
}
@article{faucris.106694544,
abstract = {The promising potential of magnetic polymer microspheres in various biomedical applications has been frequently reported. However, the surface hydrophilicity of superparamagnetic iron oxide nanoparticles (SPIONs) usually leads to poor or even failed encapsulation of SPIONs in hydrophobic polymer microspheres using the emulsion method. In this study, the stability of SPIONs in poly(3-hydroxybutyrate-co-3-hydroxyvalerate) (PHBV) solution was significantly increased after surface modification with lauric acid. As a result, magnetic PHBV microspheres with high encapsulation efficiencies (71.0-87.4%) were prepared using emulsion-solvent extraction/evaporation method. Magnetic resonance imaging (MRI) showed significant contrast for the magnetic PHBV microspheres. The toxicity of these magnetic PHBV microspheres towards human T-lymphoma suspension cells and adherent colon carcinoma HT-29 cells was investigated using flow cytometry, and they were shown to be non-toxic in a broad concentration range. A model drug, tetracycline hydrochloride, was used to demonstrate the drug delivery capability and to investigate the drug release behavior of the magnetic PHBV microspheres. The drug was successfully loaded into the microspheres using lauric acid-coated SPIONs as drug carrier, and was released from the microspheres in a diffusion controlled manner. The developed magnetic PHBV microspheres are promising candidates for biomedical applications such as targeted drug delivery and MRI.},
author = {Li, Wei and Zaloga, Jan and Ding, Yaping and Liu, Yufang and Janko, Christina and Pischetsrieder, Monika and Alexiou, Christoph and Boccaccini, Aldo R.},
doi = {10.1038/srep23140},
faupublication = {yes},
journal = {Scientific Reports},
peerreviewed = {Yes},
title = {{Facile} preparation of multifunctional superparamagnetic {PHBV} microspheres containing {SPIONs} for biomedical applications},
volume = {6},
year = {2016}
}
@article{faucris.106944244,
abstract = {The snack food potato chips induces food intake in ad libitum fed rats, which is associated with modulation of the brain reward system and other circuits. Here, we show that food intake in satiated rats is triggered by an optimal fat/carbohydrate ratio. Like potato chips, an isocaloric fat/carbohydrate mixture influenced whole brain activity pattern of rats, affecting circuits related e.g. to reward/addiction, but the number of modulated areas and the extent of modulation was lower compared to the snack food itself.},
author = {Hoch, Tobias and Kreitz, Silke and Gaffling, Simone and Pischetsrieder, Monika and Heß, Andreas},
doi = {10.1038/srep10041},
faupublication = {yes},
journal = {Scientific Reports},
note = {UnivIS-Import:2015-07-08:Pub.2015.nat.dchph.llmch.fatcar},
pages = {10041},
peerreviewed = {Yes},
title = {{Fat}/carbohydrate ratio but not energy density determines snack food intake and activates brain reward areas},
url = {http://www.nature.com/search?facets=new&journal=srep&q=SREP10041},
volume = {5},
year = {2015}
}
@article{faucris.111455784,
abstract = {Conventional fluids for peritoneal dialysis (PD) contain reactive glucose degradation products (GDPs) as a result of glucose breakdown during heat-sterilization. GDPs in PD fluids (PDFs) have been associated with the progressive alteration of the peritoneal membrane during long-term PD by cytotoxic effects and formation of advanced glycation endproducts (AGEs). In this study, we investigated the possible fate of two characteristic GDPs, 3-deoxyglucosone (3-DG) and glyoxal, during PD. In vivo, 3-DG and glyoxal concentrations, which were analyzed by high-performance liquid chromatography (HPLC), decreased in PDFs by 78% and 88% during 4 h of dwell time. The PDFs were then incubated in vitro in the presence of the most important reaction partners of GDPs in the peritoneal cavity. Neither human peritoneal mesothelial cells, human peritoneal fibroblasts, soluble protein, an insoluble collagen surface, nor components of spent dialysate led to a significant reduction of 3-DG or glyoxal after 6 h. Only after long-term incubation, a noticeable decrease of 3-DG was observed (-37% after three weeks), more likely due to spontaneous degradation reaction than formation of advanced glycation endproducts. These results suggest that in the course of PD, 3-DG, and glyoxal are absorbed into the organism and thus might contribute to the systemic pool of reactive carbonyl compounds. © 2005 Wiley-VCH Verlag GmbH & Co. KGaA.},
author = {Tauer, Andreas and Bender, Thorsten and Fleischmann, Erwin and Niwa, Toshimitsu and Jörres, Achim and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200400111},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {3-Deoxyglucosone; Advanced glycation endproducts; Continuous ambulatory peritoneal dialysis; Glucose degradation products; Glyoxal},
note = {UnivIS-Import:2015-03-09:Pub.2005.med.MKIPIII.MKIPLA.fateof},
pages = {710-715},
peerreviewed = {Yes},
title = {{Fate} of the glucose degradation products 3-deoxyglucosone and glyoxal during peritoneal dialysis},
volume = {49},
year = {2005}
}
@article{faucris.117322304,
abstract = {In addition to low pH and high osmolarity, glucose degradation products (GDPs) are considered to play a major role in the bioincompatibility of peritoneal dialysis fluids (PDFs). The formation of GDPs can be reduced by separating the glucose component of the solution (kept at very low pH) from the lactate component of the solution (kept at alkaline pH) during sterilization and storage. This development has been achieved by the use of a dual-chambered
bag. Immediately before infusion, the seam between the two chambers is opened, and the contents are mixed. The result is a fluid with a more physiologic pH in the range 6.8 – 7.4.
Concentrations of 3-deoxyglucosone (3-DG), methylglyoxal (MG), acetaldehyde (AA), and formaldehyde (FA) in Stay·Safe Balance (Fresenius Medical Care, Bad Homburg,
Germany) were remarkably reduced when compared to conventional PD solution [conventional PDF (1.5% glucose): 172 μmol/L, 6 μmol/L, 152 μmol/L, and 7 μmol/L respectively; Stay·Safe Balance (1.5% glucose): 42 μmolL, < 1 μmol/L, < 2 μmol/L, and < 3 μmol/L respectively; conventional PDF (4.25% glucose): 324 μmol/L, 10 μmol/L, 182 μmol/L, and 13 μmol/L respectively; Stay·Safe Balance (4.25% glucose): 60 μmol/L, < 1 μmol/L, < 2 μmol/L, and
< 3 μmol/L respectively).
Human peritoneal mesothelial cells (HPMCs) were exposed to a control solution, a conventional PDF [CAPD 2, 1.5% glucose (Fresenius Medical Care, Bad Homburg, Germany)], and Stay·Safe Balance, either in a co-incubation model (24-hour PDF exposure) or in a re-incubation model (30-min PDF exposure), followed by 24-hour recovery in culture medium. Interleukin-1β (IL-1β)–stimulated (1 ng/mL) IL-6 secretion from HPMCs was assessed by
ELISA. Exposure of HPMCs to conventional PDF resulted in a significant reduction in IL-6 release, which was fully restored following exposure to Stay·Safe Balance. In addition
to the short-term investigations, long-term in vitro studies were also carried out. All fluids had near-neutral pH and were changed every second day. After 1, 3, 5, 7, 10, and 13 days of exposure, cell viability was assessed. Whereas exposure to conventional PDF resulted in a significant reduction in HPMC viability after just 3 – 5 days, no significant toxicity of filter-sterilized or dual-chambered fluid was observed for up to 13 days.
An observational study with 9 patients suggested that the efficacy of Stay·Safe Balance is equivalent to that of conventional solution. However, even short-term treatment (8 ± 1 weeks) with this more biocompatible solution seems to improve mesothelial cell mass as indicated by a rise in cancer antigen 125 (CA125) from a baseline of 47 ± 37 U/min to 172 ± 90 U/min.
Our data indicate that Stay·Safe Balance may help to better preserve peritoneal membrane cell function. An ongoing European multicenter study is expected to confirm these results.},
author = {Lage, Cristina and Pischetsrieder, Monika and Aufricht, Christoph and Jörres, Achim and Schilling, Holger and Passlick-Deetjen, Jutta},
faupublication = {yes},
journal = {Peritoneal Dialysis International},
keywords = {Biocompatibility; glucose degradation products; advanced glycosylation end-products; pH-neutral peritoneal dialysis solution},
note = {UnivIS-Import:2015-03-06:Pub.2000.nat.dchph.llmch.firsti},
pages = {28-32},
peerreviewed = {Yes},
title = {{First} in vitro and in vivo experiences with stay.safe balance, a {pH}-neutral solution in a dual-chamber bag},
volume = {20},
year = {2000}
}
@article{faucris.203402007,
abstract = {Reactive 1,2-dicarbonyl compounds (DCs) are generated from carbohydrates during food processing and storage and under physiological conditions. In the recent decades, much knowledge has been gained concerning the chemical formation pathways and the role of DCs in food and physiological systems. DCs are formed mainly by dehydration and redox reactions and have a strong impact on the palatability of food, because they participate in aroma and color formation. However, they are precursors of advanced glycation end products (AGEs), and cytotoxic effects of several DCs have been reported. The most abundant DCs in food are 3-deoxyglucosone, 3-deoxygalactosone, and glucosone, predominating over methylglyoxal, glyoxal, and 3,4-dideoxyglucosone-3-ene. The availability for absorption of individual DCs is influenced by the release from the food matrix during digestion and by their reactivity towards constituents of intestinal fluids. Some recent works suggest formation of DCs from dietary sugars after their absorption, and others indicate that certain food constituents may scavenge endogenously formed DCs. First works on the interplay between dietary DCs and diseases reveal an ambiguous role of the compounds. Cancer-promoting but also anticancer effects were ascribed to methylglyoxal. Further work is still needed to elucidate the reactions of DCs during intestinal digestion and pathophysiological effects of dietary DCs at doses taken up with food and in "real" food matrices in disease states such as diabetes, uremia, and cancer.},
author = {Hellwig, Michael and Gensberger-Reigl, Sabrina and Henle, Thomas and Pischetsrieder, Monika},
doi = {10.1016/j.semcancer.2017.11.014},
faupublication = {yes},
journal = {Seminars in Cancer Biology},
pages = {1-8},
peerreviewed = {Yes},
title = {{Food}-derived 1,2-dicarbonyl compounds and their role in diseases},
volume = {49},
year = {2018}
}
@article{faucris.110507584,
author = {Ebner, Jennifer and Asci Arslan, Ayse and Fedorova, Maria and Kücükcetin, Ahmet and Pischetsrieder, Monika},
doi = {10.4455/eu.2015.023},
faupublication = {yes},
journal = {Ernährungsumschau},
note = {UnivIS-Import:2015-10-26:Pub.2015.nat.dchph.llmch.foodnu},
pages = {128-131},
peerreviewed = {Yes},
title = {{Food} - {Nutrition} - {Health}. {Biofunktionalität}, {Prävention}, {Technologische} {Eigenschaften}: {Peptide} profiling of kefir to identify bioactive components},
volume = {62},
year = {2015}
}
@article{faucris.115958524,
abstract = {Advanced glycation end products (AGEs) are formed during the nonenzymatic reaction of sugars with proteins. Conventional peritoneal dialysis fluids (PDFs) lead to the formation of AGEs in the peritoneal membrane that are associated with histopathologic changes and loss of ultrafiltration. PDFs may cause AGE formation because of a high glucose concentration or reactive glucose degradation products (GDPs), which are formed during heat sterilization of PDFs. This formation of GDPs is strongly pH dependent, which is exploited in newly developed double-chamber bag PDFs. Accordingly, 3-deoxyglucosone levels in double-chamber bag PDFs are reduced by approximately 80%, and levels of the GDPs acetaldehyde, formaldehyde, and methylglyoxal are less than the detection limit. Using an in vitro model that mimics regular changes in PDFs during continuous ambulatory peritoneal dialysis treatment, the contribution of high glucose versus GDP concentrations to AGE formation was investigated. The latter was determined by measuring protein bound N ε-(carboxymethyl)- lysine (CML) and imidazolone by enzyme-linked immunosorbent assay. In this model, more than 85% of imidazolone and more than 70% of CML were formed by GDPs, whereas only a minor part resulted from a high glucose concentration per se. New in vivo investigations suggest that GDPs from PDFs also can exert systemic effects after absorption into the blood circulation. Imidazolone levels in blood serum decrease significantly after switching from single- to double-chamber PDFs. In summary, the use of double-chamber PDFs may decrease not only local, but also systemic AGE formation. © 2003 by the National Kidney Foundation, Inc.},
author = {Tauer, Andreas and Zhang, Xiaohong and Schaub, Thomas and Zimmeck, Thomas and Niwa, Toshimitsu and Passlick-Deetjen, Jutta and Pischetsrieder, Monika},
doi = {10.1053/ajkd.2003.50086},
faupublication = {yes},
journal = {American Journal of Kidney Diseases},
keywords = {Advanced glycation end products (AGEs); N epsilon-(carboxymethyl)-lysine (CML); continuous ambulatory peritoneal dialysis (CAPD); 3-deoxyglucosone (3-DG); glucose degradation products (GDPs); imidazolone},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.format{\_}7},
pages = {S57-S60},
peerreviewed = {Yes},
title = {{Formation} of {Advanced} {Glycation} {End} {Products} {During} {CAPD}},
volume = {41},
year = {2003}
}
@article{faucris.119771124,
abstract = {Reactions between reducing sugars and proteins or amino acids (Maillard reaction) lead to the formation of yellow to brown products (melanoidins) that are important for food preparation and processing, such as baking, roasting, or malt production. Thus far, the structures of the melanoidins have not been elucidated, although some structural insights have been gained from model reactions. In this study, D-glucose was heated with an amine and two colored compounds were detected by HPLC/UV-vis. After purification, the main product was identified as [(4aS,6R,7S,8R,8aR)-4,-4a, 6,7,8,8a-hexahydro- 7,8-dihydroxy-6-hydroxymethyl- 1,4- dipropyl- 1H-pyrano [2,3 -b] pyrazine-2-yl] -1-hydroxy-3-buten-2-one (1a). For the minor compound (2a), some spectral data were obtained, but the structure was not fully characterized, 1a and 2a are the main colored compounds when the reaction is performed in alcoholic solution or on a cellulose surface. Thus, it was concluded that products with an analogous structure are important for the color formation of foodstuffs with low water activity.},
author = {Knerr, Thomas and Lerche, Holger and Pischetsrieder, Monika and Severin, Theodor},
doi = {10.1021/jf001231s},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {[(4aS, 6R, 7S, 8R, 8aR)-4, 4a, 6, 7,8,8a-hexahydro- 7,8-dihydroxy-6-hydroxymethyl-1,4-dipropyl-1H-pyrano[2,3-b]pyrazine-2- yl]-1-hydroxy-3-buten-2-one; Color formation; D-glucose; Maillard reaction; Melanoidins},
note = {UnivIS-Import:2015-03-09:Pub.2001.nat.dchph.llmch.determ{\_}2},
pages = {1966-1970},
peerreviewed = {Yes},
title = {{Formation} of a novel colored product during the {Maillard} reaction of {D}-glucose},
volume = {49},
year = {2001}
}
@article{faucris.117651424,
abstract = {The reaction of L-tryptophan (Trp) with D-glucose under conditions that can occur during food
processing and preparation was studied by high-performance liquid chromatography with diode array detection (HPLC/DAD). Besides the well-established glucose-tryptophan Amadori product (AP), (1R,3S)-1-(D-gluco-1,2,3,4,5-pentahydroxypentyl)-1,2,3,4-tetrahydro-beta-carboline-3-carboxylic acid (PHP-THbetaC) was identified as an important product of this reaction. For preparation, PHPTH betaC was obtained in high yields when Trp and D-glucose were reacted under strongly acidic conditions after heating in methanol. At elevated reaction temperatures (150 °C) 1-acetyl-beta-carboline (acetyl-betaC), was detected in significant concentrations. The mixtures were heated under variations of reaction time and temperature, and AP, PHP-THbetaC, and acetyl-betaC were quantified. In the presence of air oxygen or mild, food relevant oxidants, such as L-dehydroascorbic acid, PHP-THbetaC was readily oxidized to a product that was identified as the previously unknown 1-(D-gluco-1,2,3,4,5-pentahydroxypentyl)- beta-carboline (PHP-betaC). Formation of PHP-THbetaC and PHP-betaC in foodstuffs would deserve particular interest because multiple physiological activity of THbetaC and betaC derivatives has been shown previously.},
author = {Rönner, Birgit and Lerche, Holger and Freilinger, Christine and Bergmüller, Wolfgang and Severin, Theodor and Pischetsrieder, Monika},
doi = {10.1021/jf991237l},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Maillard reaction; tryptophan; tetrahydro-beta-carboline; beta-carboline},
note = {UnivIS-Import:2015-03-06:Pub.2000.nat.dchph.llmch.format},
pages = {2111-2116},
peerreviewed = {Yes},
title = {{Formation} of tetrahydro-ß-carbolines and ß-carbolines during the reaction of {L}-tryptophan with {D}-glucose},
volume = {48},
year = {2000}
}
@article{faucris.230228828,
abstract = {Countercurrent chromatography (CCC) is a technique, which uses two
immiscible liquid phases for a separation process in a long and hollow
tube. The technique allows the separation of high amounts of sample (50 mg to several grams) with a low consumption of solvents. In this study, we fractionated 50 mg
technical octabromodiphenyl ether (DE-79) and analyzed the fractions by
gas chromatography with mass spectrometry (GC/MS) and proton nuclear
magnetic resonance (1H NMR) spectroscopy. CCC separations were performed with n-hexane/acetonitrile
as solvent system in tail-to-head (i.e. the upper phase is mobile)
mode. Twelve CCC fractions were studied for the PBDE composition. CCC
elution of PBDE congeners was dependent both on the degree of
bromination and substitution pattern. Higher brominated congeners eluted
faster than lower brominated congeners and isomers with vicinal
hydrogen atoms eluted last. In addition to several known PBDE congeners
in DE-79, we were able to unequivocally identify BDE 195 in DE-79 and we
could verify the presence of BDE 184. Finally, we also established the
online hyphenation of CCC with 1H NMR. The use of deuterated solvents could be avoided by using n-hexane/acetonitrile as two-phase system. By online CCC-1H NMR in stop-flow mode we were able to detect eight PBDE congeners in the mixtur},
author = {Hammann, Simon and Conrad, Jürgen and Vetter, Walter},
doi = {10.1016/j.chroma.2015.04.019},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {Countercurrent chromatography; Hyphenation; NMR; Octabromo diphenyl ether},
pages = {83-93},
peerreviewed = {Yes},
title = {{Fractionation} of technical octabromodiphenyl ether by countercurrent chromatography combined with gas chromatography/mass spectrometry and offline and online {1H} nuclear magnetic resonance spectroscopy},
url = {https://www.sciencedirect.com/science/article/pii/S0021967315005622},
volume = {1398},
year = {2015}
}
@article{faucris.251032573,
abstract = {The development of functionally selective or biased ligands is a promising approach towards drugs with less side effects. Biased ligands for G protein-coupled receptors can selectively induce G protein activation or β-arrestin recruitment. The consequences of this selective action on cellular functions, however, are not fully understood. Here, we investigated the impact of five biased and balanced dopamine D2 receptor agonists and antagonists on the global protein expression in HEK293T cells by untargeted nanoscale liquid chromatography–tandem mass spectrometry. The proteome analysis detected 5290 protein groups. Hierarchical clustering and principal component analysis based on the expression levels of 1462 differential proteins led to a separation of antagonists and balanced agonist from the control treatment, while the biased ligands demonstrated larger similarities to the control. Functional analysis of affected proteins revealed that the antagonists haloperidol and sulpiride regulated exocytosis and peroxisome function. The balanced agonist quinpirole, but not the functionally selective agonists induced a downregulation of proteins involved in synaptic signaling. The β-arrestin-preferring agonist BM138, however, regulated several proteins related to neuron function and the dopamine receptor-mediated signaling pathway itself. The G protein-selective partial agonist MS308 influenced rather broad functional terms such as DNA processing and mitochondrial translation.},
author = {Wenk, Deborah and Ignatchenko, Vladimir and Macklin, Andrew and Hübner, Harald and Gmeiner, Peter and Weikert, Dorothée and Pischetsrieder, Monika and Kislinger, Thomas},
doi = {10.1038/s41598-021-83038-x},
faupublication = {yes},
journal = {Scientific Reports},
note = {CRIS-Team Scopus Importer:2021-03-05},
peerreviewed = {Yes},
title = {{Functionally} selective activation of the dopamine receptor {D2} is mirrored by the protein expression profiles},
volume = {11},
year = {2021}
}
@article{faucris.120091444,
author = {Pischetsrieder, Monika},
faupublication = {yes},
journal = {Naturwissenschaften im Unterricht - Chemie},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.funkti},
pages = {7-11},
peerreviewed = {No},
title = {{Funktionelle} {Lebensmittel} - {Functional} {Food}},
volume = {13},
year = {2002}
}
@article{faucris.257427976,
abstract = {Scope
GABAA receptors are modulated by Sideritis extracts. The aim of this study was to identify single substances from Sideritis extracts responsible for GABAA receptor modulation.
Methods and results
Single volatile substances identified by GC have been tested in two expression systems, Xenopus oocytes and human embryonic kidney cells. Some of these substances, especially carvacrol, were highly potent on GABAA receptors composed of α1β2 and α1β2γ2 subunits. All effects measured were independent from the presence of the γ2 subunit. As Sideritis extracts contain a high amount of terpenes, 13 terpenes with similar structure elements were tested in the same way. Following a prescreening on α1β2 GABAA receptors, a high-throughput method was used for identification of the most effective terpenoid substances on GABA-affinity of α1β2γ2 receptors expressed in transfected cell lines. Isopulegol, pinocarveol, verbenol, and myrtenol were the most potent modifiers of GABAA receptor function.
Conclusion
Comparing the chemical structures, the action of terpenes on GABAA receptors is most probably due to the presence of hydroxyl groups and a bicyclic character of the substances tested. We propose an allosteric modulation independent from the γ2 subunit and similar to the action of alcohols and anesthetics.
},
author = {Kessler, Artur and Sahin-Nadeem, Hilal and Lummis, Sarah C. R. and Weigel, Ingrid and Pischetsrieder, Monika and Büttner, Andrea and Villmann, Carmen},
doi = {10.1002/mnfr.201300420},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
pages = {851–862},
peerreviewed = {Yes},
title = {{GABAA} receptor modulation by terpenoids from {Sideritis} extracts.},
year = {2014}
}
@article{faucris.113834644,
abstract = {Scope: GABAA receptors are modulated by Sideritis extracts. The aim of this study was to identify single substances from Sideritis extracts responsible for GABAA receptor modulation. Methods and results: Single volatile substances identified by GC have been tested in two expression systems, Xenopus oocytes and human embryonic kidney cells. Some of these substances, especially carvacrol, were highly potent on GABAA receptors composed of α1β2 and α1β2γ2 subunits. All effects measured were independent from the presence of the γ2 subunit. As Sideritis extracts contain a high amount of terpenes, 13 terpenes with similar structure elements were tested in the same way. Following a prescreening on α1β2 GABAA receptors, a high-throughput method was used for identification of the most effective terpenoid substances on GABA-affinity of α1β2γ2 receptors expressed in transfected cell lines. Isopulegol, pinocarveol, verbenol, and myrtenol were the most potent modifiers of GABAA receptor function. Conclusion: Comparing the chemical structures, the action of terpenes on GABAA receptors is most probably due to the presence of hydroxyl groups and a bicyclic character of the substances tested. We propose an allosteric modulation independent from the γ2 subunit and similar to the action of alcohols and anesthetics. © 2013 The Authors.},
author = {Kessler, Artur and Sahin-Nadeem, Hilal and Lummis, Sarah and Weigel, Ingrid and Pischetsrieder, Monika and Büttner, Andrea and Villmann, Carmen},
doi = {10.1002/mnfr.201300420},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Patch clamp recordings; Terpene; Two-electrode voltage clamp recordings; Volatile odorants},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.gabaar},
pages = {851-862},
peerreviewed = {Yes},
title = {{GABAA} receptor modulation by terpenoids from {Sideritis} extracts},
volume = {58},
year = {2014}
}
@article{faucris.257898826,
abstract = {Sideritis spp. is a member of the Labiateae family, used in traditional folk medicine and as a calming tea preparation. Dichloromethane extracts of the aerial parts of four Sideritis species were prepared, and the volatile fractions were separated via solvent‐assisted flavour evaporation distillation. In vitro electrophysiological techniques were used to investigate the physiological effects of these aroma extracts on ionotropic γ‐aminobutyric acid receptors (GABAA) in comparison to extracts of Lavandula spp. (lavender) obtained by the same approach. The plant extracts of Sideritis spp. and Lavandula spp. increased the maximal current responses gated by the agonist GABA, both in whole cell patch clamp recordings as well as in two electrode voltage clamp assays. Thereby, the volatile fractions caused a dose‐dependent enhancement of GABAergic currents. Differences in activity between the various species were probably due to variations in odorant composition, either on a qualitative or quantitative basis. Thus, the plant material contains volatile organic compounds, which are able to modulate a GABA‐mediated response and thereby possibly contribute to a sedative effect in vivo. Copyright © 2012 John Wiley & Sons, Ltd.
Sideritis spp. is a member of the Labiateae family, used in traditional folk medicine and as a calming tea preparation. Dichloromethane extracts of the aerial parts of four Sideritis species were prepared, and the volatile fractions were separated via solvent‐assisted flavour evaporation distillation. In vitro electrophysiological techniques were used to investigate the physiological effects of these aroma extracts on ionotropic γ‐aminobutyric acid receptors (GABAA) in comparison to extracts of Lavandula spp. (lavender) obtained by the same approach. The plant extracts of Sideritis spp. and Lavandula spp. increased the maximal current responses gated by the agonist GABA, both in whole cell patch clamp recordings as well as in two electrode voltage clamp assays. Thereby, the volatile fractions caused a dose‐dependent enhancement of GABAergic currents. Differences in activity between the various species were probably due to variations in odorant composition, either on a qualitative or quantitative basis. Thus, the plant material contains volatile organic compounds, which are able to modulate a GABA‐mediated response and thereby possibly contribute to a sedative effect in vivo. Copyright © 2012 John Wiley & Sons, Ltd.
physiological effects of these aroma extracts on ionotropic g-aminobutyric acid receptors (GABAA) in comparison to extracts of Lavandula spp. (lavender) obtained by the same approach. The plant extracts of Sideritis spp. and Lavandula spp. increased the maximal current responses gated by the agonist GABA, both in whole cell patch clamp recordings as well as in two electrode voltage clamp assays. Thereby, the volatile fractions caused a dose-dependent enhancement of GABAergic currents. Differences in activity between the various species were probably due to variations in odorant composition, either on a qualitative or quantitative basis. Thus, the plant material contains volatile organic compounds, which are able to modulate a GABA-mediated response and thereby possibly contribute to a sedative effect in vivo.},
author = {Kessler, Artur and Villmann, Carmen and Sahin-Nadeem, Hilal and Pischetsrieder, Monika and Büttner, Andrea},
doi = {10.1002/ffj.3099},
faupublication = {yes},
journal = {Flavour and Fragrance Journal},
keywords = {neurotropic modulation; terpenes; GABAA receptor; ionotropic; electrophysiology},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.gabaar},
pages = {297-303},
peerreviewed = {Yes},
title = {{GABAA} receptor modulation by the volatile fractions of {Sideritis} species used as '{Greek}' or '{Turkish}' mountain tea},
volume = {27},
year = {2012}
}
@article{faucris.230229144,
abstract = {Steryl esters are high molecular weight compounds (600–700 g/mol)
regularly present as a minor lipid class in animal and plant lipids.
Different sterol backbones (e.g., cholesterol, β-sitosterol and
brassicasterol) which can be esterified with various fatty acids can
result in highly complex steryl ester patterns in food samples. The gas
chromatographic (GC) analysis of intact steryl esters is challenging,
since high elution temperatures are required for their elution. On
nonpolar GC phases, steryl esters with fatty acids with differing degree
of unsaturation (e.g., oleate and linoleate) cannot be separated and
there are only few polar columns available with sufficient temperature
stability. In this study, we used gas chromatography with mass
spectrometry (GC/MS) and analyzed intact steryl esters on a commercial
room temperature ionic liquid (RTIL) column which was shortened to a
length of 12 m. The column separated the steryl esters both by total
carbon number and by degree of unsaturation of the fatty acid. For
instance, cholesteryl esters with stearic acid (18:0), oleic acid (18:1n-9), linoleic acid (18:2n-6) and α-linolenic acid (18:3n-3) could be resolved (R ≥ 1.3)
from each other. By analysis of synthesized standard substances, the
elution orders for different steryl backbones and different fatty acids
on a given sterol backbone could be determined. Analysis of spreads and
plant oils allowed to determine retention times for 37 steryl esters,
although a few co-elutions were observed. The ionic liquid column proved
to be well-suited for the analysis of intact steryl ester},
author = {Hammann, Simon and Vetter, Walter},
doi = {10.1016/j.jchromb.2015.11.007},
faupublication = {no},
journal = {Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences},
keywords = {Gas chromatography; Ionic liquid; Mass spectrometry; Steryl ester},
pages = {67-71},
peerreviewed = {Yes},
title = {{Gas} chromatographic separation of fatty acid esters of cholesterol and phytosterols on an ionic liquid capillary column},
url = {https://www.sciencedirect.com/science/article/pii/S1570023215302713},
volume = {1007},
year = {2015}
}
@article{faucris.248370054,
abstract = {Contamination with bacteria leads to food waste and foodborne diseases with severe consequences for the environment and human health. Aiming to reduce food spoilage and infection, the present study developed novel highly active food-grade antimicrobial peptides affecting a wide range of bacteria. After extraction from chickpea, the storage protein legumin was hydrolyzed by the digestive protease chymotrypsin. Subsequent analysis by ultrahigh-performance micro-liquid chromatography–triple quadrupole time-of-flight tandem mass spectrometry determined the resulting peptide profiles. Virtual screening identified 21 potential antimicrobial peptides in the hydrolysates. Among those, the peptides Leg1 (RIKTVTSFDLPALRFLKL) and Leg2 (RIKTVTSFDLPALRWLKL) exhibited antimicrobial activity against 16 different bacteria, including pathogens, spoilage-causing bacteria and two antibiotic-resistant strains. Leg1/Leg2 showed minimum inhibitory concentrations (MIC) down to 15.6 µmol/L and were thus 10–1,000-fold more active compared to conventional food preservatives. Moreover, Leg1 and Leg2 showed bactericidal activity in contrast to the bacteriostatic activity of conventional preservatives.},
author = {Heymich, Marie-Louise and Friedlein, Ulrike and Trollmann, Marius and Schwaiger, Karin and Böckmann, Rainer and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2020.128917},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Antimicrobial peptides; Chickpea proteins; Chymotryptic hydrolysis; Cicer arietinum L.; Preservative; Virtual screening},
note = {CRIS-Team Scopus Importer:2021-01-29},
peerreviewed = {Yes},
title = {{Generation} of antimicrobial peptides {Leg1} and {Leg2} from chickpea storage protein, active against food spoilage bacteria and foodborne pathogens},
volume = {347},
year = {2021}
}
@article{faucris.111460404,
abstract = {Background. Patients with end-stage renal failure, whether on conservative or haemodialysis therapy, have a high incidence of DNA damage. It is not known if improved control of the uraemic state by daily haemodialysis (DHD) reduces DNA lesions. Methods. DNA damage in peripheral blood lymphocytes (PBLs) was evaluated in a cross-sectional study of 13 patients on DHD (2-3 h, 6 times/week), 12 patients on standard haemodialysis (SHD) therapy (4-5 h, 3 times/week) and 12 healthy age-matched volunteer controls. The biomarker of DNA damage used was micronucleus frequency. The assessed plasma parameters of microinflammation and oxidative stress were C-reactive protein (CRP), interleukin-6 (IL-6), neopterin, advanced oxidation protein products (AOPP), and homocysteine. We also measured plasma concentrations of the circulating advanced glycation end products (AGEs) MGI (methylglyoxal-derived imidazolinone), CML (carboxymethyllysine), imidazolone A (3-deoxyglucosone-derived imidazolinone) and AGE-associated fluorescence. Results. Compared to SHD, DHD was associated with significantly lower DNA damage, approaching the normal range. Micronuclei (MN) frequency averaged 29.1 MN±5.9/1000 binucleated (BN) cells in the SHD group, which is significantly elevated (P<0.01), 14.8 MN±4.0/ 1000 BN cells in the DHD group, and 13.2 MN±3.04/1000 BN cells in the controls. CRP and AOPP were in the normal range (and similar between the dialysis groups). In contrast, IL-6 and neopterin were significantly elevated, with lower values associated with DHD as compared with SHD. The increased levels of AGEs tended to be lower in the DHD group, reaching significance for CML and imidazolone A. Conclusions. Overall, it was found that genomic damage in PBLs is lower in patients on DHD than in those on SHD. Lower plasma concentrations of uraemic toxins, including circulating AGEs, may account for the differences. To confirm these data, prospective clinical trials need to be performed. © The Author [2005]. Published by Oxford University Press on behalf of ERA-EDTA. All rights reserved.},
author = {Fragedaki, Evangelia and Nebel, Michael and Schupp, Nicole and Sebekova, Katarina and Völkel, Wolfgang and Klassen, Andre and Pischetsrieder, Monika and Frischmann, Matthias and Niwa, Toshimitsu and Vienken, Jörg and Heidland, August and Stopper, Helga},
doi = {10.1093/ndt/gfh898},
faupublication = {yes},
journal = {Nephrology Dialysis Transplantation},
keywords = {Advanced glycation endproducts; Daily haemodialysis; Micronuclei frequency; Oxidative stress},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.llmch.genomi},
pages = {1936-1943},
peerreviewed = {Yes},
title = {{Genomic} damage and circulating {AGE} levels in patients undergoing daily versus standard haemodialysis},
volume = {20},
year = {2005}
}
@article{faucris.210344058,
author = {Pischetsrieder, Monika},
doi = {10.1002/anie.201803504},
faupublication = {yes},
journal = {Angewandte Chemie International Edition},
pages = {11476-11477},
peerreviewed = {Yes},
title = {{Global} {Food}-{Related} {Challenges}: {What} {Chemistry} {Has} {Achieved} and {What} {Remains} to {Be} {Done}},
volume = {57},
year = {2018}
}
@incollection{faucris.119081204,
address = {Hoboken, NJ},
author = {Pischetsrieder, Monika and Gensberger, Sabrina},
booktitle = {Uremic toxins by mass spectrometry},
doi = {10.1002/9781118424032.ch13},
editor = {Niwa, Toshimitsu},
faupublication = {yes},
isbn = {9781118135136},
keywords = {α-dicarbonyl-GDPs in PD fluids; (U)HPLC/DAD/MS/MS analysis; Glucose degradation products in PD; PD, osmotic solution into peritoneal cavity},
note = {UnivIS-Import:2015-04-20:Pub.2012.nat.dchph.llmch.glucos},
pages = {193-208},
peerreviewed = {unknown},
publisher = {John Wiley & Sons, Inc.},
series = {Wiley series on mass spectrometry},
title = {{Glucose} degradation products in peritoneal dialysis},
year = {2012}
}
@article{faucris.117434944,
abstract = {Infant formulas are milk-based products, which are adapted to the composition of human milk. To ensure microbiological safety and long shelf life, infant formulas usually undergo rigid heat treatment. As a consequence of the special composition and the heat regimen, infant formulas
are more prone to thermally induced degradation reactions than regular milk products. Degradation reactions observed during milk processing comprise lactosylation yielding the Amadori product lactulosyllysine, the formation of advanced glycation end products (AGEs), and
protein-free sugar degradation products, as well as protein or lipid oxidation. Several methods have been developed to estimate the heat impact applied during the manufacturing of infant formulas, including indirect methods such as fluorescence analysis as well as the analysis of defined reaction products. Most studies confirm a higher degree of damage in infant formulas compared to regular milk products. Differences between various types of infant formulas, such as liquid, powdered or hypoallergenic formulas depend on the analyzed markers and brands. A considerable portion of protein degradation products in infant formulas can be avoided when process parameters and the quality of the ingredients are carefully controlled. The nutritional consequences of thermal degradation products in infant formulas are largely unknown.},
author = {Pischetsrieder, Monika and Henle, Thomas},
doi = {10.1007/s00726-010-0775-0},
faupublication = {yes},
journal = {Amino Acids},
keywords = {Advanced glycation end products (AGE); Infant formula; Maillard reaction; Milk},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.glycat},
pages = {1111-1118},
peerreviewed = {Yes},
title = {{Glycation} products in infant formulas: chemical, analytical and physiological properties},
volume = {42},
year = {2012}
}
@article{faucris.120091664,
abstract = {◆ Objective: 3-Deoxyglucosone (3-DG) and acetaldehyde were found to be the major reactive carbonyl compounds in conventional heat-sterilized peritoneal dialysis fluids (PDFs). The aim of this study was to identify factors in the production of PDFs promoting or inhibiting the formation of acetaldehyde and 3-DG. ◆ Design: Single-chamber bag PDFs with different buffer systems and pH values were analyzed for acetaldehyde. 3-Deoxyglucosone was determined in double-chamber bag PDFs with different pH values, in commercially available samples, and in double-chamber products stored under defined conditions. ◆ Results: Acetaldehyde was found in the presence of lactate and malate, whereas in 2-hydroxybutanoate-buffered solution propionaldehyde was detected instead. Between pH 5.0 and 6.0 the acetaldehyde content in lactate-buffered solutions increased strongly.The concentration of 3-DG in the chamber containing glucose in double-chamber bags increased between pH 3.0 and 5.0 by a factor of 6.3-Deoxyglucosone concentrations in commercially available products vary greatly, reflecting the different pH values of these products. A time- and temperature-dependent reaction leads to a reduction in 3-DG and an increase in 5-hydroxymethyl-furan-2-carbaldehyde during storage. ◆ Conclusion: Acetaldehyde is produced by a reaction that requires both lactate and glucose. Thus, its formation can be prevented by a separation of the reaction partners, glucose and lactate, in a double-chamber bag. In double-chamber bags, pH greatly influences the formation of 3-13G. Minimal formation is observed in the region of pH 3.0. This finding should be taken into account for the development of new double-chamber bag PDFs.},
author = {Zimmeck, Thomas and Tauer, Andreas and Fünfrocken, Michael and Pischetsrieder, Monika},
faupublication = {yes},
journal = {Peritoneal Dialysis International},
keywords = {3-deoxyglucosone; Acetaldehyde; Chemical analysis; Glucose degradation products; Lactate buffer; Peritoneal dialysis fluids},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.howtor},
pages = {350-356},
peerreviewed = {Yes},
title = {{How} to {Reduce} 3-deoxyglucosone and {Acetaldehyde} in {Peritoneal} {Dialysis} {Fluids}},
year = {2002}
}
@article{faucris.307849341,
abstract = {Activation of the µ-opioid receptor (µOR) by food components could lead to reward effects or to the modulation of motor functions in the gastrointestinal tract. In an unbiased search for novel µOR agonists in food, a three-step virtual-screening process selected 22 promising candidates with potential to interact with the µOR. Radioligand binding studies showed that ten of these substances indeed bind to the receptor. Functional assays identified kukoamine A as a full agonist (EC50 = 5.6 µM) and kukoamine B as a partial agonist (EC50 = 8.7 µM) to µOR. After extraction, both kukoamines were analyzed by LC–MS/MS in potato, tomato, pepper, and eggplant. Depending on the potato variety, up to 16 µg of kukoamine A and 157 µg of kukoamine B per gram dry weight could be determined in the whole tuber, mainly concentrated in the potato peel. Cooking did not influence the kukoamine contents.},
author = {Saller, Julia and List, Carina and Hübner, Harald and Gmeiner, Peter and Clark, Timothy and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2023.136637},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Bioactive food compound; Kukoamine; Potato; Solanaceous plant; Virtual screening; µ-Opioid receptor},
note = {CRIS-Team Scopus Importer:2023-07-21},
peerreviewed = {Yes},
title = {{Identification} and quantification of kukoamine {A} and kukoamine {B} as novel μ-opioid receptor agonists in potato and other solanaceous plants},
volume = {427},
year = {2023}
}
@article{faucris.307282989,
abstract = {Resveratrol and its derivatives are valued compounds in foods such as wine. To date, their occurrence and concentrations in Franconian wines are not known. Thus, the present study investigated resveratrol and its derivatives in Franconian wines. First, comprehensive ultrahigh-performance liquid chromatography (UHPLC)-tandem mass spectrometry methods were applied to identify cis-/trans-resveratrol, cis-/trans-piceid, deoxyrhapontigenin, trans-piceatannol, and cis-/trans-astringin. Second, a sensitive UHPLC-scheduled multiple reaction monitoring method for absolute quantification of the major resveratrol derivatives was developed, validated, and applied to 19 Franconian wine samples. Recovery rates ranged between 95.0 and 109.3% and reproducibility between 2.6 and 10.3%. The limits of detection/quantification were between 0.01 and 0.08 μg/mL. The samples contained 0.07-2.61 μg/mL cis-resveratrol, 0.05-3.82 μg/mL trans-resveratrol, 0.24-9.01 μg/mL cis-piceid, and 0.25-8.30 μg/mL trans-piceid. Additionally, the concentrations of deoxyrhapontigenin (0.02-0.53 μg/mL), trans-piceatannol (0.05-1.35 μg/mL), and trans-astringin (0.04-0.67 μg/mL) were quantified.},
author = {Hoferer, Laura and Rodrigues Guimarães Abreu, Vera Lúcia and Graßl, Fabian and Fischer, Oliver and Heinrich, Markus and Gensberger-Reigl, Sabrina},
doi = {10.1021/acsfoodscitech.3c00070},
faupublication = {yes},
journal = {ACS Food Science & Technology},
keywords = {piceid; precursor ion scan; resveratrol; scheduled multiple reaction monitoring; stilbene derivatives; UHPLC−MS/MS; wine},
note = {CRIS-Team Scopus Importer:2023-07-07},
peerreviewed = {Yes},
title = {{Identification} and {Quantification} of {Resveratrol} and {Its} {Derivatives} in {Franconian} {Wines} by {Comprehensive} {Liquid} {Chromatography}-{Tandem} {Mass} {Spectrometry}},
year = {2023}
}
@article{faucris.112588784,
abstract = {High-fructose corn syrup (HFCS) is a widely used liquid sweetener produced from corn starch by hydrolysis and partial isomerization of glucose to fructose. During these processing steps, sugars can be considerably degraded, leading, for example, to the formation of reactive aα- dicarbonyl compounds (aα-DCs). The present study performed targeted screening to identify the major aα-DCs in HFCS. For this purpose, aα-DCs were selectively converted with o-phenylendiamine to the corresponding quinoxaline derivatives, which were analyzed by liquid chromatography with hyphenated diode array-tandem mass spectrometry (LC-DAD-MS/MS) detection. 3-Deoxy-D-erythro-hexos-2- ulose (3-deoxyglucosone), D-lyxo-hexos-2-ulose (glucosone), 3-deoxy-D-threo-hexos-2- ulose (3-deoxygalactosone), 1-deoxy-D-erythro-hexos-2,3-diulose (1- deoxyglucosone), 3,4-dideoxyglucosone-3-ene, methylglyoxal, and glyoxal were identified by enhanced mass spectra as well as MS/MS product ion spectra using the synthesized standards as reference. Addition of diethylene triamine pentaacetic acid and adjustment of the derivatization conditions ensured complete derivatization without de novo formation for all identified aα-DCs in HFCS matrix except for glyoxal. Subsequently, a ultra-high performance LC-DAD-MS/MS method was established to quantify 3- deoxyglucosone, glucosone, 3-deoxygalactosone, 1- deoxyglucosone, 3,4-dideoxyglucosone-3-ene, and methylglyoxal in HFCS. Depending on the aα-DC compound and concentration, the recovery ranged between 89.2% and 105.8% with a relative standard deviation between 1.9% and 6.5%. Subsequently, the aα-DC profiles of 14 commercial HFCS samples were recorded. 3-Deoxyglucosone was identified as the major aα-DC with concentrations up to 730 μg/mL HFCS. The total aα-DC content ranged from 293 μg/mL to 1,130 μg/mL HFCS. Significantly different aα-DC levels were not detected between different HFCS specifications, but between samples of various manufacturers indicating that the aα-DC load is influenced by the production procedures. © 2012 Springer-Verlag.},
author = {Gensberger, Sabrina and Mittelmaier, Stefan and Glomb, Marcus and Pischetsrieder, Monika},
doi = {10.1007/s00216-012-5817-x},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {α-Dicarbonyl compound (α-DC); High-fructose corn syrup (HFCS); o-Phenylenediamine (OPD); Quinoxaline derivatives; Sugar degradation products; Ultra high-performance liquid chromatography (UHPLC)},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.identi},
pages = {2923-2931},
peerreviewed = {Yes},
title = {{Identification} and quantification of six major alpha-dicarbonyl process contaminants in high-fructose corn syrup},
volume = {403},
year = {2012}
}
@article{faucris.117326704,
abstract = {Glucose degradation products (GDPs) formed during heat sterilization of peritoneal dialysis (PD) fluids exert cytotoxic effects and promote the formation of advanced glycation end-products in the peritoneal cavity. As a result, long-term application of continuous ambulatory peritoneal dialysis is limited. The composition and concentration of GDPs in PD fluids must be known to evaluate their biological effects. The present study describes a targeted screening for novel GDPs in PD fluids. For this purpose, dicarbonyl compounds were converted with o-phenylenediamine to give the respective quinoxaline derivatives, which were selectively monitored by HPLC/diode array detector. Glucosone was thereby identified as a novel major GDP in PD fluids. Product identity was confirmed by LC/MSMS analysis using independently synthesized glucosone as a reference compound. Furthermore, a method was developed to quantify glucosone in PD fluids by HPLC/UV after derivatization with o-phenylenediamine. The method's limit of detection was 0.6 μM and the limit of quantitation 1.1 μM. A linear calibration curve was obtained between 1.1 and 113.9 μM (R2 = 0.9999). Analyzed at three different concentration levels, recovery varied between 95.6% and 102.0%. The coefficient of variation ranged between 0.4% and 4.7%. The method was then applied to the measurement of glucosone in typical PD fluids. Glucosone levels in double chamber bag PD fluids varied between not detectable and 6.7 μM. In single chamber bag fluids, glucosone levels ranged between 28.7 and 40.7 μM. © 2010 Elsevier B.V. All rights reserved.},
author = {Mittelmaier, Stefan and Fünfrocken, Michael and Fenn, Dominik and Fichert, Thomas and Pischetsrieder, Monika},
doi = {10.1016/j.jchromb.2010.02.004},
faupublication = {yes},
journal = {Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences},
keywords = {[alpha]-Dicarbonyl compounds; Glucose degradation products (GDPs); Glucosone; HPLC; Peritoneal dialysis fluid; Quinoxaline derivatives},
note = {UnivIS-Import:2015-03-09:Pub.2010.nat.dchph.llmch.identi{\_}4},
pages = {877-882},
peerreviewed = {Yes},
title = {{Identification} and quantification of the glucose degradation product glucosone in peritoneal dialysis fluids by {HPLC}/{DAD}/{MSMS}},
volume = {878},
year = {2010}
}
@article{faucris.108255444,
abstract = {Health-promoting effects of kefir may be partially caused by bioactive peptides. To evaluate their formation or degradation during gastrointestinal digestion, we monitored changes of the peptide profile in a model of (1) oral, (2) gastric, and (3) small intestinal digestion of kefir. Matrix-assisted laser desorption/ionization time-of-flight mass spectroscopy analyses revealed clearly different profiles between digests 2/3 and kefir/digest 1. Subsequent ultraperformance liquid chromatography-electrospray ionization-tandem mass spectrometry identified 92 peptides in total (25, 25, 43, and 30, partly overlapping in kefir and digests 1, 2, and 3, respectively), including 16 peptides with ascribed bioactivity. Relative quantification in scheduled multiple reaction monitoring mode showed that many bioactive peptides were released by simulated digestion. Most prominently, the concentration of angiotensin-converting enzyme inhibitor β-casein203-209 increased approximately 10 000-fold after combined oral, gastric, and intestinal digestion. Thus, physiological digestive processes may promote bioactive peptide formation from proteins and oligopeptides in kefir. Furthermore, bioactive peptides present in certain compartments of the gastrointestinal tract may exert local physiological effects.},
author = {Liu, Yufang and Pischetsrieder, Monika},
doi = {10.1021/acs.jafc.6b05385},
faupublication = {yes},
journal = {Journal of agricultural and food chemistry},
keywords = {Kefir; peptide profile; bioactive peptides; gastrointestinal digestion},
pages = {1865-1873},
peerreviewed = {unknown},
title = {{Identification} and {Relative} {Quantification} of {Bioactive} {Peptides} {Sequentially} {Released} during {Simulated} {Gastrointestinal} {Digestion} of {Commercial} {Kefir}.},
volume = {65},
year = {2017}
}
@article{faucris.121025344,
abstract = {During milk processing, proteins can be severely modified by oxidation, condensation, and Maillard reaction, leading to changes in their nutritional and technological properties. In this study, major modifications of β-lactoglobulin, formed during the heating and processing of milk, were screened by mass spectrometry. For this purpose, β-lactoglobulin was isolated from the milk samples by gel electrophoresis and analyzed by matrix-assisted laser desorption/ionization mass spectrometry after in-gel digestion with endoproteinase AspN. In heated milk, lactulosyllysine was detected at lysine 47 and 138 or 141 as well as methionine sulfoxide at methionine 7, 24, and 145. All these modifications increased gradually when raw milk was heated for 20, 40, and 60 min at 120°C. The major modifications were also relatively quantified in dairy products, such as raw, high-temperature, ultra-high-temperature, sterilized, and condensed milk as well as infant formulas. The highest contents of lactulosyllysine at Lys47 were detected in powdered infant formulas, whereas lactulosyllysine at Lys138/141 was predominant in condensed milk samples. Methionine sulfoxide at Met7 and Met24 showed a trend toward higher modification rates in more severely processed products. © 2008 American Chemical Society.},
author = {Meltretter, Jasmin and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1021/jf800571j},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {β-Lactoglobulin; Glycation; Maillard reaction; Matrix-assisted laser desorption/ionization mass spectrometry; Milk; Oxidation},
note = {UnivIS-Import:2015-04-14:Pub.2008.nat.dchph.llmch.identi},
pages = {5165-5171},
peerreviewed = {Yes},
title = {{Identification} and {Site} {Specific} {Relative} {Quantification} of beta-{Lactoglobulin} {Modifications} in {Heated} {Milk} and {Dairy} {Products}},
volume = {56},
year = {2008}
}
@article{faucris.211172855,
abstract = {Glucose degradation products (GDPs) are formed from glucose and other reducing sugars during heat treatment, for example, in heat-sterilized peritoneal dialysis fluids or foods. Because of their reactive mono- and dicarbonyl structure, they react readily with proteins, resulting in the formation of advanced glycation end products (AGEs), loss of protein functionality, and cytotoxicity. Among the GDPs, 3,4-dideoxyglucosone-3-ene (3,4-DGE) exerts the strongest effects despite its relatively low concentration levels. The goal of the present study was therefore to identify the structure of specific protein modifications deriving from 3,4-DGE. A nonapeptide containing the reactive amino acids lysine, arginine, and cysteine was incubated with 3,4-DGE and the dominant GDPs 3-deoxyglucosone (3-DG) and 3-deoxygalactosone (3-DGal) in concentrations as present in peritoneal dialysis fluids (235 μM 3-DG, 100 μM 3-Gal, and 11 μM 3,4-DGE). Glycation rate and product formation were determined by ultra-HPLC-MS/MS (UHPLC-MS/MS). 3,4-DGE showed the strongest glycation activity. After 2 h of incubation, 3,4-DGE had modified 57% of the nonapeptide, whereas 3-DG had modified only 2% and 3-DGal had modified 29% of the peptide. A stable 3,4-DGE-derived cysteine modification was isolated. Its structure was determined by comprehensive NMR and MS experiments to be [6-hydroxy-2-(hydroxymethyl)-5-oxo-5,6-dihydro-2 H-pyran-3-yl]-cysteine (HHPC), which represents a novel cysteine-AGE derived from 3,4-DGE. The results indicate that 3,4-DGE might contribute to a severe loss of protein functionality by forming cysteine-specific AGEs, such as HHPC.},
author = {Gensberger-Reigl, Sabrina and Atzenbeck, Lisa and Göttler, Alexander and Pischetsrieder, Monika},
doi = {10.1021/acs.chemrestox.8b00320},
faupublication = {yes},
journal = {Chemical Research in Toxicology},
month = {Jan},
pages = {304-311},
peerreviewed = {Yes},
title = {{Identification} of [6-{Hydroxy}-2-(hydroxymethyl)-5-oxo-5,6-dihydro-2 {H}-pyran-3-yl]-cysteine ({HHPC}) as a {Cysteine}-specific {Modification} {Formed} from 3,4-{Dideoxyglucosone}-3-ene (3,4-{DGE}).},
volume = {32},
year = {2019}
}
@article{faucris.121049764,
abstract = {Coffee, a highly processed food, and Maillard mixtures are able to activate nuclear factor kB
translocation in macrophages via generation of hydrogen peroxide. In this study, a substructure library was prepared and used to identify Maillard products that are responsible for this effect. Three different Maillard reaction products with aminoreductone substructure (C6-aminoreductone, C4-aminoreductone, and aminohexose reductone) strongly induce nuclear factor kB translocation in macrophages. The effect was almost completely blocked by
co-incubation with catalase, indicating that cellular activation was mediated by the ability of
the test compounds to generate hydrogen peroxide. The cellular effect of a Maillard mixture,
which was produced under conditions favoring aminoreductone formation, could be almost
completely related to the presence of C6-aminoreductone.},
author = {Wühr, Andrea and Deckert, Melanie and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200900308},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Aminoreductone; Hydrogen peroxide; Macrophages; Maillard reaction products; Nuclear factor kappa B},
note = {UnivIS-Import:2015-04-14:Pub.2010.nat.dchph.llmch.identi},
pages = {1021-1030},
peerreviewed = {Yes},
title = {{Identification} of aminoreductones as active components in {Maillard} reaction mixtures inducing nuclear {NF}-{kappaB} translocation in macrophages},
volume = {54},
year = {2010}
}
@article{faucris.298191334,
abstract = {Hop is widely used in beer brewing and as a medicinal product. The present study comprehensively analyzed the main molecular determinants of the antibacterial activity of hop extracts. Minimum inhibitory concentrations (MIC) against Bacillus subtilis between 31.25 and 250 µg/mL were found in the ethanolic extracts of five hop varieties for beer brewing, but not in the tea hop sample. Activity-guided fractionation revealed the highest antibacterial activity for lupulone and adlupulone (MIC 0.98 µg/mL). Metabolome profiling and subsequent multistep statistical analysis detected 33 metabolites out of 1826 features to be associated with the antibacterial activity including humulone, adhumulone, colupulone, lupulone, and adlupulone. Xanthohumol, the three humulone- and three lupulone congeners were quantified in the hop extracts by a validated ultrahigh-performance liquid chromatography–mass spectrometry method. Considering concentrations and MICs, colupulone and lupulone were identified as major contributors to the antibacterial activity of hop extract with the highest antibacterial activity values (concentration/MIC) of 1.59 and 2.56.},
author = {Li, Yan and Dalabasmaz, Sevim and Gensberger-Reigl, Sabrina and Heymich, Marie-Louise and Krofta, Karel and Pischetsrieder, Monika},
doi = {10.1016/j.foodres.2023.112832},
faupublication = {yes},
journal = {Food Research International},
keywords = {Antibacterial activity; Hop; Humulone; Humulus lupulus; Lupulone; Metabolome; Quantification},
note = {CRIS-Team Scopus Importer:2023-04-28},
peerreviewed = {Yes},
title = {{Identification} of colupulone and lupulone as the main contributors to the antibacterial activity of hop extracts using activity-guided fractionation and metabolome analysis},
volume = {169},
year = {2023}
}
@article{faucris.116318224,
abstract = {Methylglyoxal (MG) is a sugar degradation product, which is endogenously formed by fragmentation of triose phosphates during glycolysis, ketone body metabolism of acetone, and catabolism of threonine. Food, beverages, and medical products are important exogenous sources with concentrations of up to 100 μM MG. MG is a reactive dicarbonyl compound, which easily modifies amino groups of proteins (glycation reaction) and thereby induces proinflammatory responses. Moreover, increased mutation frequencies in mammalian cells after treatment with MG have been reported, which are caused by stable modifications of DNA bases. Thus far, two types of adducts have been identified, which are formed during the reaction of free guanine or 2′-deoxyguanosine with high MG concentrations. In this study, we investigated the prolonged exposure of DNA to physiological MG concentrations. DNA was incubated with MG, enzymatically hydrolyzed to release the free nucleosides, and then analyzed by LC-MS/MS. We detected four products, which were derived from the reaction of 2′-deoxyguanosine and 2′-deoxyadenosine with 1 and 2 equiv of MG each. The adducts with 1 equiv of MG were identified as N2-(1- carboxyethyl)-2′-deoxyguanosine (CEdG) and N6-(1-carboxyethyl)- 2′-deoxyadenosine. LC-MS/MS was optimized for these compounds, and incubation of DNA was repeated using physiological concentrations of 10 μM MG. Thereby, CEdG proved to be the most sensitive and suitable marker for the reaction of DNA with MG (negative MRM mode, three mass transitions [M - 1] - 338→178, 338→106, and 338→149). © 2005 American Chemical Society.},
author = {Frischmann, Matthias and Bidmon, Clemens and Angerer, Jürgen and Pischetsrieder, Monika},
doi = {10.1021/tx0501278},
faupublication = {yes},
journal = {Chemical Research in Toxicology},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.llmch.identi},
pages = {1586-1592},
peerreviewed = {Yes},
title = {{Identification} of {DNA} adducts of methylglyoxal},
url = {http://pubs.acs.org/cgi-bin/download.pl?tx0501278/w4bL},
volume = {18},
year = {2005}
}
@article{faucris.118723264,
abstract = {The spice Syzygium aromaticum L. (clove buds) exerts topical anesthetic and analgesic effects. Since GABA(A) receptors are an emerging drug target for pain treatment, the effects of aqueous clove extracts on the human alpha 1 beta 2-GABA(A) receptor were tested by two-electrode voltage clamp technique applying a three-step test system. The extract significantly and specifically potentiated the GABA-induced currents by an allosteric mechanism in concentration-dependent manner (0.5-5 mu g/mL up to 426 +/- 23%) HPLC-based activity-guided fractionation revealed eugenol as main determinant of this GABAergic activity. Acetyleugenol, an important component of clove bud oil, showed even higher activity than eugenol (1 mu g/mL; 308 +/- 26% versus 234 +/- 29%), but was detected in the aqueous extract only in trace amounts. Thus, the analgesic effects of clove might be partially mediated by positive modulation of the GABAA receptor and eugenol is a major contributor to this activity. (C) 2017 Elsevier Ltd. All rights reserved.},
author = {Sahin, Sümeyye and Eulenburg, Volker and Heinlein, Anja and Villmann, Carmen and Pischetsrieder, Monika},
doi = {10.1016/j.jff.2017.08.033},
faupublication = {yes},
journal = {Journal of Functional Foods},
keywords = {Acetyleugenol;Analgesic activity;Clove buds;Eugenol;GABA(A) receptor;Two-electrode voltage clamp technique},
pages = {641-649},
peerreviewed = {Yes},
title = {{Identification} of eugenol as the major determinant of {GABA}({A})-receptor activation by aqueous {Syzygium} aromaticum {L}. (clove buds) extract},
volume = {37},
year = {2017}
}
@article{faucris.121053504,
abstract = {Coffee shows distinct antimicrobial activity against several bacterial genera. The present study investigated molecular mechanisms and active ingredients mediating the antimicrobial effect of coffee. Depending on concentration, roasted, but not raw coffee brew inhibited the growth of Escherichia coli and Listeria innocua. Several coffee ingredients with known antibacterial properties were tested for their contribution to the observed effect. In natural concentration, caffeine, ferulic acid and a mixture of all test compounds showed very weak, but significant activity, whereas trigonelline, 5-(hydroxymethyl)furfural, chlorogenic acid, nicotinic acid, caffeic acid, and methylglyoxal were not active. Antimicrobial activity, however, was completely abolished by addition of catalase indicating that H2O2 is a major antimicrobial coffee component. In accordance with this assumption, bacterial counts during 16 h of incubation were inversely related to the H 2O2 concentration in the incubation solution. Pure H 2O2 showed slightly weaker activity. The H 2O2 dependent antimicrobial activity of coffee could be mimicked by a reaction mixture of d-ribose and l-lysine (30 min 120 °C) indicating that H2O2 is generated in the coffee brew by Maillard reaction products. Identification of H2O2 as major antimicrobial coffee component is important to evaluate the application of coffee or coffee extracts as natural preservatives. © 2011 The Royal Society of Chemistry.},
author = {Müller, Ulla and Sauer, Tanja and Weigel, Ingrid and Pichner, Rohtraud and Pischetsrieder, Monika},
doi = {10.1039/c0fo00180e},
faupublication = {yes},
journal = {Food & Function},
note = {UnivIS-Import:2015-04-14:Pub.2011.nat.dchph.llmch.identi},
pages = {265-272},
peerreviewed = {Yes},
title = {{Identification} of {H2O2} as a major antimicrobial component in coffee},
volume = {2},
year = {2011}
}
@article{faucris.117041804,
abstract = {The cytotoxic activity of Maillard reaction products and coffee was studied using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium bromide (MTT) assay and the neutral red uptake (NRU) assay. Equimolar mixtures of sugars and lysine were heated at 12°8C and used to stimulate bovine aorta endothelial cells for 24 h. The cytotoxic activity increased with increase in educt concentration and heating time. Mixtures containing ribose were most active, followed by lactose and glucose. Hydrogen peroxide, which was present in the Maillard mixtures in concentrations between 7 and 87 μM, was identified as one of their major cytotoxic components. H2O2-concentrations increased further up to 130 μM under cell culture conditions. Filter coffee, espresso, and green coffee extract reduced cell viability significantly to 10, 19, and 83% of PBS-treated control. The effect was largely attenuated by the addition of catalase. Nil, 33, and 41 μM H2O2 was measured in green coffee extract, filter coffee, and espresso, respectively, increasing to 13, 369, and 333 μM during cell culture conditions. No additional H2O2 formation was detected when coffee was incubated for up to 5 h without further treatment. In conclusion, hydrogen peroxide is a major product in Maillard mixtures and coffee inducing cell death in vitro. © 2009 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.},
author = {Hegele, Jörg and Münch, Gerald and Pischetsrieder, Monika},
doi = {10.1002/mnfr.200800221},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {Bovine aorta endothelial cells; Coffee; Cytotoxicity; Hydrogen peroxide; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2009.nat.dchph.llmch.identi},
pages = {760-769},
peerreviewed = {Yes},
title = {{Identification} of hydrogen peroxide as a major cytotoxic component in {Maillard} reaction mixtures and coffee},
volume = {53},
year = {2009}
}
@article{faucris.112979064,
abstract = {Multiphosphorylated peptides endogenously present in milk exert anticariogenic activity due to their calcium binding capacity. This study performed comprehensive analysis of multiphosphorylated peptides in raw milk using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS). Since phosphopeptides are often negatively discriminated during ionization, putative phosphopeptides were identified by three different methods: (i) selective detection in 4-chloro-α- cyanocinnamic acid MALDI matrix compared to α-cyano-4-hydroxycinnamic acid; (ii) higher relative signal intensity in negative compared to positive ionization mode; and (iii) detection of signal pairs with mass differences of -80 Da or multiples thereof before and after enzymatic dephosphorylation. Thus, 18 putative phosphopeptides from raw milk were annotated. Peptide structures were then determined by product ion spectra from targeted liquid chromatography electrospray ionization tandem-MS analysis. Thus, β-casein33-48, β-casein29-48, β-casein1-21, β-casein 2-25, β-casein1-25, β-casein1-27, β-casein1-28, β-casein1-29, β-casein 1-32, αS2-casein1-21, and αS2-casein1-24 were revealed as major peptides with one or four phosphorylation sites in raw milk. © 2013 American Chemical Society.},
author = {Baum, Florian and Ebner, Jennifer and Pischetsrieder, Monika},
doi = {10.1021/jf401865q},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {casein phosphopeptides; MALDI-TOF-MS; mass spectrometry; milk; native multiphosphorylated peptides},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.identi{\_}3},
pages = {9110-9117},
peerreviewed = {Yes},
title = {{Identification} of multiphosphorylated peptides in milk},
url = {http://pubs.acs.org/articlesonrequest/AOR-wwaXN9DeAYMBJYSpy9uM},
volume = {61},
year = {2013}
}
@article{faucris.223658436,
abstract = {Proteolysis during the storage of UHT milk is associated with major technological problems, particularly bitter
off-flavors and age gelation limiting the shelf life of milk. In this study, untargeted peptide profiling by MALDITOF-
MS identified peptides that were formed by proteolysis and reflected the storage of UHT milk. Analysis of
nine different commercial UHT samples recorded peptide profiles during and at the end of their shelf life.
Relative quantification and sequencing of the peptides revealed that the concentrations of 22 peptides increased
significantly during the storage of UHT milk due to the activity of endogenous milk proteases and microbial
proteases as well as other unidentified proteolytic mechanisms. Based on highly discriminative AUC values from
receiver operator characteristic (ROC) curve analysis, we selected ten peptides as marker candidates. Among
those, the peptide β-casein192–206 (m/z 1668.9) was the most suitable marker differentiating expired-UHT from
regular-UHT samples with 100% accuracy. Additionally, β-casein191–206 (m/z 1782.0) showed 100% specificity
and β-casein139–161 (m/z 2696.4) 100% sensitivity. Thus, β-casein192–206, either by itself or in combination with
β-casein191–206 and β-casein139–161, presents a reliable marker to monitor the storage of UHT milk based on
proteolytic mechanisms.
},
author = {Dalabasmaz, Sevim and Dittrich, Daniel and Kellner, Ina and Drewello, Thomas and Pischetsrieder, Monika},
doi = {10.1016/j.jprot.2019.103444},
faupublication = {yes},
journal = {Journal of Proteomics},
keywords = {Peptide profiling; milk proteases; storage; UHT milk; MALDI-TOF-MS},
pages = {103444},
peerreviewed = {Yes},
title = {{Identification} of peptides reflecting the storage of {UHT} milk by {MALDI}-{TOF}-{MS} peptide profiling.},
url = {https://authors.elsevier.com/a/1ZVHp6gB-WXHON},
volume = {207},
year = {2019}
}
@article{faucris.311087954,
abstract = {Sheep farming is an important socioeconomic activity in most Mediterranean countries, particularly Spain, where it contributes added value to rural areas. Sheep milk is used in Spain mainly for making cheese, but it can be used also for making other dairy products, such as the lactic-alcoholic fermentation product known as kefir. Dairy products have health benefits because, among other reasons, they contain molecules with biological activity. In this work, we performed a proteomics strategy to identify the peptidome, i.e., the set of peptides contained in sheep milk kefir fermented for four different periods of time, aiming to understand changes in the pattern of digestion of milk proteins, as well as to identify potential bioactive peptides. In total, we identified 1942 peptides coming from 11 different proteins, and found that the unique peptides differed qualitatively among samples and their numbers increased along the fermentation time. These changes were supported by the increase in ethanol, lactic acid, and D-galactose concentrations, as well as proteolytic activity, as the fermentation progressed. By searching in databases, we found that 78 of the identified peptides, all belonging to caseins, had potential biological activity. Of these, 62 were not previously found in any milk kefir from other animal species. This is the first peptidomic study of sheep milk kefir comprising time-course comparison.},
author = {Dalabasmaz, Sevim and de la Torre, Esther Prados and Gensberger-Reigl, Sabrina and Pischetsrieder, Monika and Rodríguez-Ortega, Manuel J.},
doi = {10.3390/foods12152974},
faupublication = {yes},
journal = {Foods},
keywords = {biopeptides; dairy; fermented milk; peptidome; proteomics; sheep},
note = {CRIS-Team Scopus Importer:2023-09-29},
peerreviewed = {Yes},
title = {{Identification} of {Potential} {Bioactive} {Peptides} in {Sheep} {Milk} {Kefir} through {Peptidomic} {Analysis} at {Different} {Fermentation} {Times}},
volume = {12},
year = {2023}
}
@article{faucris.122319164,
abstract = {Peptide profiles of different drinking milk samples were examined to study how the peptide fingerprint of milk reflects processing conditions. The combination of a simple and fast method for peptide extraction using stage tips and MALDI–TOF–MS enabled the fast and easy generation and relative quantification of peptide fingerprints for high-temperature short-time (HTST), extended shelf life (ESL) and ultra-high temperature (UHT) milk of the same dairies. The relative quantity of 16 peptides changed as a function of increasing heat load. Additional heating experiments showed that among those, the intensity of peptide β-casein 196–209 (m/z 1460.9 Da) was most heavily influenced by heat treatment indicating a putative marker peptide for milk processing conditions. Storage experiments with HTST- and UHT milk revealed that the differences between different types of milk samples were not only caused by the heating process. Relevant was also the proteolytic activity of enzymes during storage, which were differently influenced by the heat treatment. These results indicate that the peptide profile may be suitable to monitor processing as well as storage conditions of milk.},
author = {Ebner, Jennifer and Baum, Florian and Pischetsrieder, Monika},
doi = {10.1016/j.jprot.2016.03.021},
faupublication = {yes},
journal = {Journal of Proteomics},
keywords = {Milk; MALDI–TOF–MS; Peptide profiling; Processing marker; Storage marker; Heat treatment},
pages = {66-75},
peerreviewed = {Yes},
title = {{Identification} of sixteen peptides reflecting heat and/or storage induced processes by profiling of commercial milk samples},
volume = {147},
year = {2016}
}
@article{faucris.123950244,
abstract = {The dopamine D2 receptor (D2R) is involved in food reward and compulsive food intake. The present study developed a virtual screening (VS) method to identify food components, which may modulate D2R signalling. In contrast to their common applications in drug discovery, VS methods are rarely applied for the discovery of bioactive food compounds. Here, databases were created that exclusively contain substances occurring in food and natural sources (about 13,000 different compounds in total) as the basis for combined pharmacophore searching, hit-list clustering and molecular docking into D2R homology models. From 17 compounds finally tested in radioligand assays to determine their binding affinities, seven were classified as hits (hit rate = 41%). Functional properties of the five most active compounds were further examined in β-arrestin recruitment and cAMP inhibition experiments. D2R-promoted G-protein activation was observed for hordenine, a constituent of barley and beer, with approximately identical ligand efficacy as dopamine (76%) and a Ki value of 13 μM. Moreover, hordenine antagonised D2-mediated β-arrestin recruitment indicating functional selectivity. Application of our databases provides new perspectives for the discovery of bioactive food constituents using VS methods. Based on its presence in beer, we suggest that hordenine significantly contributes to mood-elevating effects of beer.},
author = {Sommer, Thomas and Hübner, Harald and El Kerdawy, Ahmed and Gmeiner, Peter and Pischetsrieder, Monika and Clark, Timothy},
doi = {10.1038/srep44201},
faupublication = {yes},
journal = {Scientific Reports},
pages = {44201},
peerreviewed = {Yes},
title = {{Identification} of the {Beer} {Component} {Hordenine} as {Food}-{Derived} {Dopamine} {D2} {Receptor} {Agonist} by {Virtual} {Screening} a {3D} {Compound} {Database}.},
url = {http://rdcu.be/pX4k},
volume = {7},
year = {2017}
}
@article{faucris.117523604,
abstract = {The endocannabinoid system is important in various physiological pathways, especially the regulation of food intake. It consists of endocannabinoids like 2-arachidonoyl-glycerol (2-AG) or the fatty acid ethanolamide archachidonoyl-ethanolamide (AEA) with binding affinity to cannabinoid receptors. Further, fatty acid ethanolamides (FAEAs) influence the endocannabinoid system without affecting cannabinoid receptors by using independent physiological pathways. Among FAEAs, oleic acid ethanolamide (OEA) gained importance because of its promising ability to reduce food intake. By ultrahigh-performance liquid chromatography–electrospray ionization–tandem mass spectrometry (UHPLC–ESI–MS/MS), we detected a chromatographically separated molecule in plasma samples from rats and humans with identical mass and fragmentation patterns as those of OEA. Via synthesis and extensive analysis of ethanolamides of different cis/trans- and position isomers of oleic acid (cis9-18:1), we could identify the unknown molecule as vaccenic acid (cis11-18:1) ethanolamide (VEA). In this study we identified VEA as the most abundant 18:1 FAEA in rat plasma and the second most abundant 18:1 FAEA in human plasma.},
author = {Röhrig, Waldemar and Waibel, Reiner and Perlwitz, Christopher and Pischetsrieder, Monika and Hoch, Tobias},
doi = {10.1007/s00216-016-9720-8},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {OEA; VEA; fatty acid ethanolamides; endocannabinoid system; LC - MS/MS},
pages = {6141-6151},
peerreviewed = {Yes},
title = {{Identification} of the oleic acide ethanolamide ({OEA}) isomer cis-vaccenic acid ethanolamide ({VEA}) as a highly abundant 18:1 fatty acid ethanolamide in blood plasma from rats and humans},
url = {http://rdcu.be/niov},
volume = {408},
year = {2016}
}
@article{faucris.119988044,
abstract = {In this study, a new approach was introduced to identify marker peptides that reflect the thermal treatment of commercial milk samples and differentiate ultrahigh-temperature processed (UHT) milk from mildly heated milk. Peptide profiles of training set samples, pasteurized (n = 20), extended shelf life (n = 29), and UHT (n = 29) milk, were recorded by MALDI-TOF-MS after StageTip microextraction. As marker candidates, 13 peptides were selected, and their cutoff levels were defined. The quality of the cutoff levels was then tested with a blind test set. Thus, the peptide m/z 1701.0, which was identified as pyroQ-beta casein(194-209), could ideally differentiate UHT milk from mildly heated milk with an accuracy of 100%. Due to its high reliability and sensitivity, this peptide may be applied in routine analysis to monitor thermal processing of milk. An additional heating experiment showed that the marker peptide candidates are formed during milk processing by endogenous enzymes and selective thermal cleavage.},
author = {Dalabasmaz, Sevim and Ebner, Jennifer and Pischetsrieder, Monika},
doi = {10.1021/acs.jafc.7b03801},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Peptide profiling; marker peptide; milk; heating; PCA; MALDI-TOF-MS},
pages = {10781-10791},
peerreviewed = {Yes},
title = {{Identification} of the {Peptide} {PyroQ}-beta {Casein}(194-209) as a {Highly} {Specific} and {Sensitive} {Marker} to {Differentiate} between {Ultrahigh}-{Temperature} {Processed} ({UHT}) {Milk} and {Mildly} {Heated} {Milk}},
volume = {65},
year = {2017}
}
@article{faucris.119802364,
abstract = {A total of 152 different meat products (emulsion-type sausages, cooked sausages, fermented raw sausages) originating from local butchers shops and supermarkets were analysed for the presence of tissues from the central nervous system (CNS) by a newly developed Western blot assay using myelin proteolipid protein (PLP) as specific marker. Samples tested positive were analysed in parallel with a commercialized ELISA kit based on the detection of glial fibrillary acidic protein (GFAP). Analysing retail meat products by PL Passay, 9.9% of the samples (15 out of 152) showed positive PLP responses. The positive findings were confirmed in five cases (3.3 %) by application of the GFAP-ELISA. With both methods, very strong signals were detected in two sausages originating from a small butcher shop. Repeated sampling and analyses of these products during a period of several months proved the initial findings indicating a systematic contamination or addition of CNS material. The detection of nearly 10 % of CNS-positive sausages demonstrates that intentional or unintentional contaminations of retail meat products are not uncommon. Overall, the PLP assay was confirmed to be a highly sensitive method for the detection of CNS in both heat-treated and raw fermented sausages. Thus it could be applied for routine and food control purposes. © M.&H. Schaper GmbH&Co.},
author = {Hammon, Antje and Düthorn, Tina and Bäuerlein, Rainer and Becker, Cord-Michael and Pischetsrieder, Monika and Pichner, Rohtraud and Gareis, Manfred},
doi = {10.2377/0003-925X-58-214},
faupublication = {yes},
journal = {Archiv für Lebensmittelhygiene},
keywords = {Central nervous system (CNS); Meat products; Myelin proteolipid protein (PLP); Western blotting},
note = {UnivIS-Import:2015-04-14:Pub.2007.nat.dchph.llmch.immuno},
pages = {214-219},
peerreviewed = {Yes},
title = {{Immunochemical} {Detection} of {Central} {Nervous} {Tissue} in {Retail} {Meat} {Products} {Using} {Myelin} {Proteolipid} {Protein} ({PLP}) as {Marker}},
volume = {58},
year = {2007}
}
@article{faucris.112181344,
abstract = {Bovine spongiform encephalopathy (BSE) is transmitted by the ingestion of central nervous system (CNS) tissue of infected animals. Food inspection must, therefore, test for the presence of CNS tissue in meat and meat products. A Western blot assay for the specific CNS tissue marker myelin proteolipid protein (PLP) was optimized with considerably reduced analysis time, solvent consumption, and detection limit (0.001% CNS tissue in minced beef). Further, a PLP-specific recombinant bivalent fragment antigen binding mini-antibody (anti-PLP Fab) was obtained from a commercial phage display library. Western blot analysis with the anti-PLP Fab selectively detected CNS tissue in minced beef with a detection limit of 0.025%. Model experiments for meat processing revealed that assay sensitivity decreased with increasing temperature and prolonged heating time. A market survey with 687 sausage samples was performed using PLP-Western blot and enzyme-linked immunosorbent assay (ELISA) for glial fibrillary acidic protein (GFAP). Five samples were tested clearly positive by both assay systems, whereas in an additional six samples, CNS tissue was detected only by GFAP ELISA and in two samples only by PLP-Western blot.},
author = {Weigel, Ingrid and Schulze, Gesine and Pischetsrieder, Monika},
doi = {10.1021/jf100625g},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Bovine spongiform encephalopathy (BSE); central nervous system (CNS); myelin proteolipid protein (PLP); monoclonal antibody; recombinant bivalent Fab mini-antibodies; phage display library; Western blot},
note = {UnivIS-Import:2015-03-09:Pub.2010.nat.dchph.llmch.immuno},
pages = {6587-6593},
peerreviewed = {Yes},
title = {{Immunochemical} detection of tissue from the central nervous system via myelin proteolipid protein: adaption for food inspection and development of recombinant bivalent {Fab} mini-antibodies},
url = {http://pubs.acs.org/articlesonrequest/AOR-SJAPwfvBzfFumwVRgYej},
volume = {58},
year = {2010}
}
@article{faucris.117643724,
abstract = {This study examined the effect of methylglyoxal (MGO)-derived nonenzymatic posttranslational modifications (nePTMs) on the binding affinity of S100A12 to its natural receptor for advanced glycation end-products (RAGE). Binding of MGOmodified S100A12 to RAGE decreased significantly with increasing MGO concentration and incubation time. Ca2+-induced S100A12 hexamerization was impaired only at higher MGO concentrations indicating that the loss of affinity is not predominantly caused by disturbance of ligand oligomerization. nePTM mapping showed carboxyethylation of lysine (CEL) and the N-terminus without preferential modification sites. Besides, hydroimidazolone, hemiaminals, argpyrimidine, and tetrahydropyrimidine rapidly formed at R21. Even at the highest modification rate, hexamerization of synthesized CEL-S100A12 was unaffected and RAGE-binding only slightly impaired. Thus, nePTMs at R21 seem to be the major cause of MGOinduced impairment of S100A12 oligomerization and RAGE binding.},
author = {Augner, Kerstin and Eichler, Jutta and Utz, Wolfgang and Pischetsrieder, Monika},
doi = {10.1371/journal.pone.0113418},
faupublication = {yes},
journal = {PLoS ONE},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.influe},
pages = {e113418},
peerreviewed = {Yes},
title = {{Influence} of nonenzymatic posttranslational modifications on constitution, oligomerization and receptor binding of {S100A12}},
url = {http://dx.plos.org/10.1371/journal.pone.0113418},
volume = {9},
year = {2014}
}
@article{faucris.257901273,
abstract = {The release of four volatile flavour compounds (cis-3-hexen-1-ol, benzaldehyde, ethyl butanoate and butyl isovalerate) from pure water and various low-viscosity aqueous solutions (sucrose, maltitol, erythritol, polydextrose and oligofructose, each at 20% (w/w)) was investigated. Dynamic headspace concentrations of the flavour compounds at thermodynamic equilibrium were monitored by proton-transfer-reaction mass spectrometry (PTR-MS). The rheological properties of the solutions were characterised by their viscosity. Flavour release from pure water increased with increasing hydrophobicity and volatility of the flavour compounds. The highly volatile compounds were retained more extensively in the presence of sucrose, polyols and bulking agents, compared to in pure water, whereas an increase in the release of the less volatile cis-3-hexen-1-ol was observed. All aqueous solutions had similar viscosities, although bulking agent solutions tended to have higher viscosities than polyol solutions of the same concentration. A correlation between viscosity and flavour release in the low-viscosity solutions was not evident.
grains was investigated. The growth of yeasts, lactic acid bacteria (LAB) and acetic acetic bacteria (AAB) in both grains and kefir was affected by the incubation temperature and by the use of back-slopping. In particular, at 25 °C the microbiota of kefir grains was mainly composed by LAB and yeasts, while at 18 °C yeasts represented the dominant group in kefir. Back-slopping at 25 °C determined a significant increase of AAB.
A comprehensive characterization of potentially bioactive peptides, including caseino-phosphopeptides
(CPPs), was performed, for the first time, in kefir obtained with kefir grains, using preliminary enrichment on
hydroxyapatite followed by dephosphorylation and analysis by Liquid Chromatography-ElectroSpray Ionization-Quadrupole-Time of Flight-tandem mass spectrometry (LC-ESI-QTOF-MS/MS). As a result, seventy-three phosphopeptides, mostly arising from caseins (79% β-casein, 8% αs1-casein and 9% αs2-casein) and all including from three to five serine residues in their sequences, were identified. Seventy-one of them showed the typical motif “SerP-SerP-SerP-Glu-Glu”, which is crucial for the ability of caseins to bind to minerals. Several peptides were observed, for the first time, from the 1–40 region of β-casein. As for the effect of production technology, phosphopeptide profiles of kefirs obtained at 25 °C and 18 °C were very similar, whereas kefir produced under acidic conditions showed a predominance of smaller peptides, suggesting a higher level of proteolysis. Conversely, kefir obtained through back-slopping at 25 °C contained longer peptides, thus indicating a lower proteolytic activity and a poor reproducibility in the kefir phosphopeptide profile occurring when grains are reused.
2-carboxyethyl- 2′-deoxyguanosine (CEdG) was quantified in nuclear DNA and mtDNA by ELISA, whereas the protein-AGEs N-(carboxymethyl)lysine (CML) and N ε-(carboxyethyl)lysine (CEL) were determined by western blot. The method was used to analyze NIH3T3 fibroblasts. In untreated cells, CEdG levels of mtDNA (14.84 ± 3.07 pg CEdG/μg mtDNA) were significantly higher compared with nuclear DNA (4.40 ± 0.64 pg CEdG/μg DNA; p < 0.001). Then, fibroblasts were analyzed after 7 days of senescence-like growth arrest. In senescent fibroblasts, the CEdG content of nuclear DNA significantly increased by 25%. However, the CEdG level of mtDNA significantly decreased to 52%; in parallel, an increase in mitochondrial mass and mtDNA was observed. Senescence did not lead to general accumulation of protein-AGEs, but two protein bands at 32 and 34 kDa showed a significant increase in the CML/CEL modification rate (208%, p < 0.001; 196%, p = 0.0016) in senescent fibroblasts compared with control cells. © Copyright 2011, Mary Ann Liebert, Inc.},
author = {Breyer, Viola and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1089/dna.2011.1236},
faupublication = {yes},
journal = {DNA and Cell Biology},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.intrac},
pages = {681-689},
peerreviewed = {Yes},
title = {{Intracellular} glycation of nuclear {DNA}, mitochondrial {DNA}, and cytosolic proteins during senescence-like growth arrest},
volume = {30},
year = {2011}
}
@article{faucris.122514524,
abstract = {1,8-Cineole, a common and widely used odorant with antiphlogistic and anti-inflammatory properties, was investigated in this study with regard to potential physiological effects targeting mainly its intestinal effects. Accordingly, the aim of the study was to utilize a combinatory methodological approach to both monitor potential biotransformatory effects on a chemo-analytical basis, as well as physiological and immunological tools to monitor further effects of biofeedback. Reverse transcription quantitative real-time polymerase chain reaction was used to monitor the occurrence of relative expression changes for particular marker genes, following 1,8-cineole treatment. Furthermore, a potential effect of 1,8-cineole on the proliferation and fitness of the intestinal cells using impedance sensing was studied. Generally, our studies showed that the applied model system did neither lead to any significant metabolite formation, nor did the applied dosages result in any major modifications with regard to gene expression. Also, it was shown that cineole had no effect on the intestinal porcine epithelial cells applied in pharmacological or physiological concentrations; neither during the attachment and spreading process nor on confluent cell layers. Only the exposure to high concentrations of cineole (> 1g/l) affected the cells and led to massive cell detachment. Overall, our studies show that even common higher 1,8-cineole dosages do not seem to lead to any major physiological or aversive response, only until a critical concentration is reached that then directly leads to cell death within the intestinal model. © 2012 John Wiley & Sons, Ltd.},
author = {Müller, Jakob and Gruner, Natalie and Almstätter, Isabella and Kirsch, Frauke and Büttner, Andrea and Pfaffl, Michael},
doi = {10.1002/ffj.3109},
faupublication = {yes},
journal = {Flavour and Fragrance Journal},
keywords = {ECIS; Gas chromatography-mass spectrometry; Hydroxycineole; Metabolism; RT-qPCR; Stable isotope dilution assay},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.invest},
pages = {405-413},
peerreviewed = {Yes},
title = {{Investigation} into the metabolism of 1,8-cineole in an intestinal cell culture model and acquisition of its immune-modulatory effect via gene expression analysis},
volume = {27},
year = {2012}
}
@article{faucris.117858664,
abstract = {α-Dicarbonyl compounds are intermediates in reactions that lead to the formation of potentially harmful advanced glycation end-products. Carbonyl-trapping capacities of antiglycative substances have been traditionally limited to C2 and C3 α-dicarbonyl structures. Glyoxal (GO)-, methylglyoxal (MGO)-, 3-deoxyglucosone (3-DG)-, 3-deoxygalactosone (3-DGal)-, 3,4-dideoxyglucoson-3-ene-, and glucosone-trapping capacities of hydroxytyrosol (HT), hydroxytyrosol acetate (HTA), and 3,4-dihydroxyphenylacetic acid (DOPAC) in simple (phenolic/dicarbonyl) and competitive model systems (phenolic/dicarbonyl1/dicarbonyl2) were investigated. HT and HTA were more effective for MGO than 3-DG and 3-DGal. Furthermore, DOPAC exerted higher trapping capacity than HT and HTA for C3 and C6 α-dicarbonyl compounds. In the competitive systems, HT-related substances did not show preference for trapping 3-DG or 3-DGal and behaved as in the simple systems. In the presence of MGO, however, HT-related substances were more effective for trapping MGO than C6 structures. The results demonstrate the C6 α-dicarbonyl-trapping capacities of HT, HTA, and DOPAC, with DOPAC exerting the highest activity.},
author = {Navarro, Marta and Atzenbeck, Lisa and Pischetsrieder, Monika and Morales, Francesco},
doi = {10.1021/acs.jafc.6b01423},
faupublication = {yes},
journal = {Journal of agricultural and food chemistry},
keywords = {hydroxytyrosol; α-dicarbonyl compounds; carbonyl-trapping capacity; 3-deoxyglucosone; 3-deoxygalactosone; methylglyoxal},
pages = {6327-32},
peerreviewed = {Yes},
title = {{Investigations} on the {Reaction} of {C3} and {C6} α-{Dicarbonyl} {Compounds} with {Hydroxytyrosol} and {Related} {Compounds} under {Competitive} {Conditions}.},
volume = {64},
year = {2016}
}
@article{faucris.119773324,
abstract = {Conventional peritoneal dialysis fluids (PDFs) lead to formation of advanced glycation end-products (AGE) in the peritoneal membrane. In this study, we investigated in vitro the dependence of AGE formation on regular changes of PDFs, as performed during continuous
ambulatory peritoneal dialysis (CAPD), and on the contribution of high glucose concentration versus glucose degradation products (GDPs). Under conditions similar to CAPD, protein glycating activity of a conventional single chamber bag PDF (CAPD 4.25%), two double chamber bag PDFs (CAPD Balance 4.25% and CAPD Bicarbonate 4.25%) and a sterile filtered
control was measured in vitro by Ne-(carboxymethyl) lysine (CML) and imidazolones, two well characterized, physiologically relevant AGE structures. Regular changes of PDFs increased AGE formation (CML 3.3-fold and imidazolone 2.6-fold) compared to incubation without changes. AGE formation by CAPD 4.25% was increased compared to control (imidazolones
7.9-fold and CML 3.3-fold) and the use of double chamber bag PDFs led to a decrease of imidazolones by 79% (CAPD Bicarbonate 4.25%) and by 66% (CAPD Balance 4.25%) and to CML contents similar to the control. These results indicate that a major part of AGEs were formed by GDPs in PDFs, whereas only a minor part was due to high glucose concentration. The use of double chamber bag fluids can reduce AGE formation considerably.},
author = {Tauer, Andreas and Knerr, Thomas and Niwa, Toshimitsu and Schaub, Thomas and Lage, Cristina and Passlick-Deetjen, Jutta and Pischetsrieder, Monika},
doi = {10.1006/bbrc.2001.4294},
faupublication = {yes},
journal = {Biochemical and Biophysical Research Communications},
keywords = {advanced glycation end-products; Ne-(carboxymethyl) lysine; CML; imidazolones;, glucose degradation products, peritoneal dialysis; 3-deoxyglucosone},
note = {UnivIS-Import:2015-03-09:Pub.2001.nat.dchph.llmch.invitr},
pages = {1408-1414},
peerreviewed = {Yes},
title = {{In} vitro formation of {Nepsilon} -(carboxymethyl)lysine and imidazolones under conditions similar to continous ambulatory peritoneal dialysis ({CAPD})},
volume = {280},
year = {2001}
}
@article{faucris.273931361,
abstract = {3,4-Dideoxyglucosone-3-ene (3,4-DGE) is a glucose degradation product present in processed foods and medicinal products. Additionally, its constant formation from 3-deoxyglucosone in plasma has been suggested. Due to its α,β-unsaturated dicarbonyl moiety, 3,4-DGE is highly reactive and has shown harmful effects in vitro. Here, we investigated the impact of major components of the human blood circulatory system on 3,4-DGE in vitro. Under physiological conditions, plasma concentrations of human serum albumin (HSA) reacted efficiently with 3,4-DGE, resulting in only 8.5% of the initial 3,4-DGE concentration after seven hours (vs. 83.4% without HSA, p < 0.001). Thereby, accessible thiol groups were reduced from 0.121 to 0.064 mol/mol HSA, whereas ketoprofen binding and esterase-like activity of HSA were not affected. Plasma concentrations of glutathione (GSH) reacted immediately and completely with 3,4-DGE, leading to two stereoisomeric adducts. Plasma concentrations of immunoglobulin G (IgG) bound to 3,4-DGE to a lower extent, resulting in 62.6% 3,4-DGE after seven hours (vs. 82.2% in the control, p < 0.01). Immobilized human collagen type IV did not alter 3,4-DGE concentrations. The results indicated that particularly HSA, GSH, and IgG readily scavenge 3,4-DGE after its appearance in the blood stream, which may be associated with a reduced antioxidative and cytoprotective activity for the living cells and, thus, the human organism by blocking free thiol groups.},
author = {Auditore, Andrea and Gensberger-Reigl, Sabrina and Pischetsrieder, Monika},
doi = {10.3390/ijms23094557},
faupublication = {yes},
journal = {International Journal of Molecular Sciences},
keywords = {3,4-dideoxyglucosone-3-ene (3,4-DGE); collagen type IV; diabetes; glucose degradation product; glycation; human serum albumin; immunoglobulin G; L-glutathione; oxidative stress; α,β-unsaturated dicarbonyl},
note = {CRIS-Team Scopus Importer:2022-04-29},
peerreviewed = {Yes},
title = {{In} {Vitro} {Reactivity} of the {Glucose} {Degradation} {Product} 3,4-{Dideoxyglucosone}-3-ene (3,4-{DGE}) towards {Abundant} {Components} of the {Human} {Blood} {Circulatory} {System}},
volume = {23},
year = {2022}
}
@article{faucris.230229471,
abstract = {The lipids of gymnosperms frequently feature unusual polyunsaturated
fatty acids (PUFAs) such as sciadonic acid (20:3Δ5,11,14) and
juniperonic acid (20:4Δ5,11,14,17) showing a first double bond on C-5
which is separated from the next double bond by five methylene units.
Compared to “classic” fatty acids, these fatty acids are not easily
commercially available and their prices are quite high. For this reason,
we wished to isolate those fatty acids from the seed oil of Podocarpus falcatus
by countercurrent chromatography (CCC) after conversion of the fatty
acids to methyl esters (FAMEs). The contribution of sciadonic acid
(20:3Δ5,11,14) and juniperonic acid (20:4Δ5,11,14,17) in the
unfractionated sample was 10% and 6% respectively, while oleic acid
(18:1Δ9) and linoleic acid (18:2Δ9,12) were the major fatty acids. After
a first CCC run with FAMEs from Podocarpus falcatus, fractions
enriched in the target compounds were chosen for subsequent isolation
by means of two subsequent CCC runs. Initially, 13 mg of juniperonic
acid was recovered with a purity of 92% according to analysis by gas
chromatography with mass spectrometry (GC/MS). Further purification of
this fraction yielded 2.7 mg with a purity of 99% according to GC/MS.
The isolation of sciadonic acid was hampered by high amounts of linoleic
acid with the same equivalent chain length in suitable fractions of the
first CCC separation. After an enrichment step by CCC, the critical
pair sciadonic acid and linoleic acid was finally separated as free
fatty acids. After this step, 4.4 mg of sciadonic acid was recovered
with 99% purity. The methodology could also be applied to isolate larger
amounts of those fatty acids or for the isolation of other minor fatty
acid},
author = {Hammann, Simon and Schröder, Markus and Schmidt, Carolin and Vetter, Walter},
doi = {10.1016/j.chroma.2015.03.042},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {Countercurrent chromatography; Gas chromatography; Polyunsaturated fatty acid; Mass spectrometry; Podocarpus falcatus},
pages = {89-94},
peerreviewed = {Yes},
title = {{Isolation} of two δ5 polymethylene interrupted fatty acids from {Podocarpus} falcatus by countercurrent chromatography},
url = {https://www.sciencedirect.com/science/article/pii/S0021967315004525},
volume = {1394},
year = {2015}
}
@article{faucris.230229830,
abstract = {A carotenoid purification method with dual-mode countercurrent
chromatography (CCC) for β-carotene, α-carotene and lutein from a fresh
carrot extract was developed. The fluorinated liquid benzotrifluoride
(IUPAC name: (trifluoromethyl)benzene) was used as a novel modifier in
the non-aqueous ternary solvent system n-hexane/benzotrifluoride/acetonitrile.
The ternary phase diagram of the type I solvent system was used to
select two-phase solvent mixtures which enabled an efficient preparative
separation of α-carotene, β-carotene and lutein from concomitant
pigments in crude carrot extract. By means of the modifier, high
separation factors (α ≥ 1.2) were obtained, allowing baseline
resolution between α-carotene and β-carotene due to specific chemical
interactions such as π–π molecular interactions. After optimizing the
injection step with a pseudo-ternary phase diagram, 51 mg of β-carotene, 32 mg of α-carotene and 4 mg of lutein could be isolated from 100.2 mg
crude carrot extract in a short time and with high purities of 95% and
99% by using dual-mode CCC, respectively. Temperatures >22 °C had a negative impact on the separation of α-carotene and β-caroten},
author = {Englert, Michael and Hammann, Simon and Vetter, Walter},
doi = {10.1016/j.chroma.2015.02.020},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {(trifluoromethyl)benzene; Benzotrifluoride; Countercurrent chromatography; Carotenoids; Carrots},
pages = {119-125},
peerreviewed = {Yes},
title = {{Isolation} of β-carotene, α-carotene and lutein from carrots by countercurrent chromatography with the solvent system modifier benzotrifluoride},
url = {https://www.sciencedirect.com/science/article/pii/S0021967315002459},
volume = {1388},
year = {2015}
}
@article{faucris.110548284,
abstract = {Four 'amadoriase' enzyme fractions, which oxidatively degrade glycated low molecular weight amines and amino acids under formation of hydrogen peroxide and glucosone, were isolated from an Aspergillus sp. soil strain selected on fructosyl adamantanamine as sole carbon source. The enzymes were purified to homogeneity using a combination of ion exchange, hydroxyapatite, gel filtration, and Mono Q column chromatography. Molecular masses of amadoriase enzymes Ia, Ib, and Ic were 51 kDa, and 49 kDa for amadoriase II. Apparent kinetic constants for N(ε)-fructosyl N(α)-t-butoxycarbonyl lysine and fructosyl adamantanamine were almost identical for enzymes Ia, Ib, and Ic, but corresponding values for enzyme II were significantly different. FAD was identified in all enzymes based on its typical absorption spectrum. N- terminal sequence was identical for enzymes Ia and Ib (Ala-Pro-Ser-Ile-Leu- Ser-Thr-Glu-Ser-Ser-Ile-Ile-Val-Ile-Gly-Ala-Gly-Thr-Trp-Gly-) and Ic except that the first 5 amino acids were truncated. The sequence of enzyme II was different (Ala-Val-Thr-Lys-Ser-Ser-Ser-Leu-Leu-Ile-Val-Gly-Ala-Gly-Thr-Trp- Gly-Thr-Ser-Thr-). All enzymes had the FAD cofactor-binding consensus sequence Gly-X-Gly-X-X-Gly within the N-terminal sequence. In summary, these data show the presence of two distinct amadoriase enzymes in the Aspergillus sp. soil strain selected on fructosyl adamantanamine and induced by fructosyl propylamine. In contrast to previous described enzymes, these novel amadoriase enzymes can deglycate both glycated amines and amino acids.},
author = {Takahashi, Motoko and Pischetsrieder, Monika and Monnier, Vincent},
doi = {10.1074/jbc.272.6.3437},
faupublication = {no},
journal = {Journal of Biological Chemistry},
note = {UnivIS-Import:2015-03-05:Pub.1997.nat.dchph.llmch.isolat},
pages = {3437-3443},
peerreviewed = {Yes},
title = {{Isolation}, {Purification} and {Characterization} of {Amadoriase} {Isoenzymes} ({Fructosyl} {Amine}: {Oxygen} {Oxidoreductase} {EC} 1.5.3.) from {Aspergillus} sp},
volume = {272},
year = {1997}
}
@article{faucris.230225071,
abstract = {
Minor lipids in cereals (such as
phytosterols and alkylresorcinols) can be important for human nutrition
and/or be used as biomarkers for cereal intake. However, the analysis of
cereal lipids is very challenging due to the complex lipidome
comprising several hundred individual compounds present over a wide
range of concentrations.
Here we present a method for
the profiling of cereal lipids using high temperature gas chromatography
coupled to high resolution mass spectrometry (GC/Q-TOF MS). The method
was used to investigate the lipid profiles of 77 samples of bread wheat,
spelt, einkorn, emmer, barley, rye and oats.
Distinct
differences in the patterns of alkylresorcinols, free and conjugated
sterols and tocopherols between the cereals could be observed.
Furthermore, traces of tocomonoenols and diunsaturated and
methyl-alkylresorcinols (not previously reported in cereals) could be
detected. Finally, the lipid patterns in the cereals could be used to
separate the cereals by Principal Component Analysis.
},
author = {Hammann, Simon and Korf, Ansgar and Bull, Ian D. and Hayen, Heiko and Cramp, Lucy J. E.},
doi = {10.1016/j.foodchem.2018.12.109},
faupublication = {no},
journal = {Food Chemistry},
keywords = {Tocopherol; Sterol; Principal Component Analysis; Alkylresorcinol; Lipid; Mass spectrometry; Cereal; Gas chromatography},
pages = {27-35},
peerreviewed = {Yes},
title = {{Lipid} profiling and analytical discrimination of seven cereals using high temperature gas chromatography coupled to high resolution quadrupole time-of-flight mass spectrometry},
url = {https://www.sciencedirect.com/science/article/pii/S0308814619300184},
volume = {282},
year = {2019}
}
@incollection{faucris.114542824,
abstract = {The enzyme lysozyme can be used as a preservative in cheese to prevent late gas blowing caused by Clostridia and provides an alternative to nitrate or the bacteriocin nisin. Lysozyme acts against Gram-positive bacteria by hydrolysing the peptidoglycan layer between the sugar derivatives N-acetylglucosamine and N-acetylmuramic acid. For the use as food additive, it is produced from hen egg white, which contains the highest natural amounts of this enzyme (about 3.5% of the total protein content). However, lysozyme entails allergy risks representing one of the egg allergens besides the major hen egg white proteins ovalbumin, ovotransferrin (conalbumin), and ovomucoid. Different investigations addressing possible allergic reactions to lysozyme-containing cheese by skin prick tests, radioallergosorbent tests and double-blind, placebo-controlled food challenges came to controversial conclusions. Some studies found correlations between the consumption of lysozyme-containing cheese and acute allergic reactions, whereas in a recently published work, egg allergic patients did not show allergy symptoms after the oral intake of cheese containing lysozyme. In summary, it cannot be excluded that sufferers from an egg allergy show adverse reactions to lysozyme used as preservative in cheese. Therefore, the declaration of lysozyme on the packaging of lysozyme-containing cheese is mandatory.},
address = {Wageningen, NL},
author = {Schneider, Nadine and Pischetsrieder, Monika},
booktitle = {Handbook of Cheese in Health: Production, Nutrition and Medical Sciences},
doi = {10.3920/978-90-8686-766-0{\_}50},
editor = {Preedy, V.R.; Ross Watson, R.; Patel, V.B.},
faupublication = {yes},
isbn = {978-90-8686-766-0},
keywords = {Food allergy; Hen's egg; Lysozyme; Preservative},
pages = {765-780},
peerreviewed = {unknown},
publisher = {Wageningen Academic Publishers},
series = {Human Health Handbooks},
title = {{Lysozyme} allergen in cheese and potential impact on health},
volume = {6},
year = {2013}
}
@article{faucris.120129504,
abstract = {Investigation of the colored products formed by the reaction of D-glucose with butylammonium acetate has been extended. The previously unknown 1-N-butyl-4-hydroxy-5-methyl-2-(N-butyl-3-hydroxy-5-(2-hydroxyethyl) pyrrolyl-2-methylidene)-2H-pyrrolin-3-one (2a) was isolated from the reaction mixture and identified after acylation by spectroscopic data. Butylaminammonium acetate was used as a model compound representing the lysine side chains of proteins.},
author = {Lerche, Holger and Pischetsrieder, Monika and Severin, Theodor},
doi = {10.1021/jf034092y},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Color formation; D-glucose; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.mailla},
pages = {4424-4426},
peerreviewed = {Yes},
title = {{Maillard} {Reaction} of d-{Glucose}: {Identification} of a {Colored} {Product} with {Hydroxypyrrole} and {Hydroxypyrrolinone} {Rings} {Connected} by a {Methine} {Group}},
volume = {51},
year = {2003}
}
@article{faucris.115829824,
abstract = {Formation of colored compounds during the Maillard reaction of D-glucose with butylammonium acetate in aqueous solution has been investigated. Butylamine was used as a model compound analogous to the lysine side chains of proteins. The previously unknown, yellow product, 4-hydroxy-5-methyl-2-(N-butyl-3-hydroxy-5-(2-hydroxyethyl) pyrrolyl-2-methylidene)-2H-furan-3-one (1a), was isolated from the reaction mixtures and identified by spectroscopic data.},
author = {Lerche, Holger and Pischetsrieder, Monika and Severin, Theodor},
doi = {10.1021/jf0114031},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Color formation; D-glucose; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.mailla},
pages = {2984-2986},
peerreviewed = {Yes},
title = {{Maillard} {Reaction} of {Glucose}. {Identification} of a colored product with conjugated pyrrole and furanone rings},
volume = {50},
year = {2002}
}
@article{faucris.113834864,
abstract = {Active packaging foils with incorporated antimicrobial agents release the active ingredient during food storage. Maillard reaction products (MRPs) show antimicrobial activity that is at least partially mediated by H 2O2. De novo generation of H2O2 by an MRP fraction, extracted from a ribose/lysine Maillard reaction mixture by 85% ethanol, was monitored at three concentrations (1.6, 16.1, and 32.3 g/L) and three temperatures (4, 25, and 37 C) between 0 and 96 h, reaching a maximum of 335 μM H2O2 (32.3 g/L, 37 C, 96 h). The active MRP fraction (16.1 g/L) completely inhibited the growth of Escherichia coli for 24 h and was therefore incorporated in a polyvinyl acetate-based lacquer and dispersed onto a low-density polyethylene film. The coated film generated about 100 μM H2O2 and resulted in a log-reduction of >5 log-cycles against E. coli. Thus, MRPs can be considered as active ingredients for antimicrobial packaging materials. © 2013 Elsevier Ltd. All rights reserved.},
author = {Hauser, Carolin and Müller, Ulla and Sauer, Tanja and Augner, Kerstin and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2013.08.083},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Active packaging; Antimicrobial films; Hydrogen peroxide; Maillard reaction products; Preservation},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.mailla},
pages = {608-613},
peerreviewed = {Yes},
title = {{Maillard} reaction products as antimicrobial components for packaging films},
volume = {145},
year = {2014}
}
@article{faucris.111045484,
abstract = {Dietary intake of antioxidants has been associated with a reduced risk of cardiovascular diseases, which is very likely caused by their capability of prevent oxidation of low-density lipoproteins (LDL). During food processing and storage, substances with antioxidative properties are formed by Maillard reactions. In this study, the activity of Maillard products to inhibit copper-induced oxidation of human LDL in vitro was investigated. D-Glucose was heated with an equimolar amount of glycine, L-lysine, or L-arginine, for 1 h under reflux. The increase of the antioxidative activity (AOA) of the Maillard mixtures was highly significant compared to the control mixtures. Additionally, two defined Maillard products with amino reductone structure were tested. 3-Hydroxy-4-(morpholino)-3-buten-2-one (1) and amino hexose reductone (2) showed a significant and dose dependent AOA. Compound 1 was about half as active as ascorbic acid, which served as positive control. Thus, it can be concluded that Maillard products, particularly those with amino reductone structure, have the strong potential to inhibit LDL oxidation.},
author = {Dittrich, Ralf and El-Massry, Khaled Farouk and Kunz, Katrin and Rinaldi, Francesco and Peich, Carlo and Beckmann, Matthias and Pischetsrieder, Monika},
doi = {10.1021/jf026172s},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Amino hexose reductone; Amino reductones; LDL oxidation; Low-density lipoprotein; Maillard reaction},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.mailla{\_}0},
pages = {3900-3904},
peerreviewed = {Yes},
title = {{Maillard} {Reaction} {Products} {Inhibit} {Oxidation} of {Human} {Low}-{Density} {Lipoproteins} in {Vitro}},
url = {http://pubs.acs.org/cgi-bin/download.pl?jf026172s/0286},
volume = {51},
year = {2003}
}
@article{faucris.112594284,
author = {Pischetsrieder, Monika and Meltretter, Jasmin},
faupublication = {yes},
journal = {Deutsche Lebensmittel-Rundschau},
note = {UnivIS-Import:2015-03-09:Pub.2012.nat.dchph.llmch.mailla},
pages = {392-396},
peerreviewed = {Yes},
title = {{Maillard}-{Reaktion} und {AGEs}. {Auf} der {Suche} nach neuen {Produkten}},
volume = {108},
year = {2012}
}
@article{faucris.112383524,
abstract = {The major modifications induced by thermal treatment of whey proteins α-lactalbumin (α-La) and β-lactoglobulin (β-Lg) in a model system mimicking lactose-free milk (L- sugar mix) were investigated by matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS). The analysis of the intact α-La revealed species with up to 7 and 14 adducts from lactose and sugar mix, respectively, whereas for β-Lg 3 and up to 5 sugar moieties were observed in the case of lactose and sugar mix experiments, respectively. A partial enzymatic hydrolysis with endoproteinase AspN prior to mass spectrometric analysis allowed the detection of further modifications and their localization in the amino acid sequence. Using α-cyano-4-chlorocinnamic acid as MALDI matrix, it could be shown that heating α-La and β-Lg with glucose or galactose led to the modification of lysine residues that are not glycated by lactose. The higher glycation degree of whey proteins in a lactose-free milk system relative to normal milk with lactose reflects the higher reactivity of monosaccharides compared to the parent disaccharide. Finally, the analysis of the whey extract of a commercial lactose-free milk sample revealed that the two whey proteins were present as three main forms (native, single, and double hexose adducts). © 2011 American Chemical Society.},
author = {Carulli, Saverio and Calvano, Cosima and Palmisano, Francesco and Pischetsrieder, Monika},
doi = {10.1021/jf104131a},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {AspN; glycation; lactose-free milk; MALDI mass spectrometry; whey proteins},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.maldit},
pages = {1793-1803},
peerreviewed = {Yes},
title = {{MALDI}-{TOF} {MS} {Characterization} of glycation products of whey proteins in a glucose/galactose model system and lactose-free milk},
url = {http://pubs.acs.org/articlesonrequest/AOR-8Kf29uHmHrQuFrHhE4Ca},
volume = {59},
year = {2011}
}
@article{faucris.115403684,
abstract = {Non-homeostatic hyperphagia, which is a major contributor to obesity-related hyperalimentation, is associated with the diet's molecular composition influencing, for example, the energy content. Thus, specific food items such as snack food may induce food intake independent from the state of satiety. To elucidate mechanisms how snack food may induce non-homeostatic food intake, it was tested if manganese-enhanced magnetic resonance imaging (MEMRI) was suitable for mapping the whole brain activity related to standard and snack food intake under normal behavioral situation. Application of the MnCl2 solution by osmotic pumps ensured that food intake was not significantly affected by the treatment. After z-score normalization and a non-affine three-dimensional registration to a rat brain atlas, significantly different grey values of 80 predefined brain structures were recorded in ad libitum fed rats after the intake of potato chips compared to standard chow at the group level. Ten of these areas had previously been connected to food intake, in particular to hyperphagia (e.g. dorsomedial hypothalamus or the anterior paraventricular thalamic nucleus) or to the satiety system (e.g. arcuate hypothalamic nucleus or solitary tract); 27 areas were related to reward/addiction including the core and shell of the nucleus accumbens, the ventral pallidum and the ventral striatum (caudate and putamen). Eleven areas associated to sleep displayed significantly reduced Mn2+-accumulation and six areas related to locomotor activity showed significantly increased Mn2+-accumulation after the intake of potato chips. The latter changes were associated with an observed significantly higher locomotor activity. Osmotic pump-assisted MEMRI proved to be a promising technique for functional mapping of whole brain activity patterns associated to nutritional intake under normal behavior.},
author = {Hoch, Tobias and Kreitz, Silke and Gaffling, Simone and Pischetsrieder, Monika and Heß, Andreas},
doi = {10.1371/journal.pone.0055354},
faupublication = {yes},
journal = {PLoS ONE},
peerreviewed = {Yes},
title = {{Manganese}-{Enhanced} {Magnetic} {Resonance} {Imaging} for {Mapping} of {Whole} {Brain} {Activity} {Patterns} {Associated} with the {Intake} of {Snack} {Food} in {Ad} {Libitum} {Fed} {Rats}},
volume = {8},
year = {2013}
}
@article{faucris.112383964,
abstract = {Milk processing leads to severe protein damage caused by the formation of nonenzymatic
posttranslational modifications (nePTMs), such as glycation and glycoxidation. As a result, the technological and nutritional function of milk proteins can be critically altered. The present study investigated the protein-specific distribution of the glycoxidation product Ne-carboxymethyllysine (CML) in the proteome of processed milk. For this purpose, raw milk and heated milk were separated by 1-D or 2-DE. The distribution of CML in the milk proteome was examined by immunoblotting. The changes in the protein composition that occurred during heating were monitored by Coomassie staining. Relative modification rates were measured for the major milk protein fractions after 30 and 60 min of heating at 1201C and normalized to the content of the respective protein fraction in the samples. The highest glycoxidation rates were detected in the high molecular weight aggregates that are generated during heating. The casein fraction and the whey protein b-lactoglobulin were affected in a similar manner. The relevance of the results for industrial milk processing was confirmed by analyzing several commercial milk products accordingly. The presented approach allows nonenzymatic posttranslational modification mapping of the entire milk proteome.},
author = {Meyer, Bianca and Al-Diab, Dima and Vollmer, Gregor and Pischetsrieder, Monika},
doi = {10.1002/pmic.201000233},
faupublication = {yes},
journal = {Proteomics},
keywords = {2-DE; Advanced glycation end-products; Glycoproteomics; Milk proteome; Nepsilon-carboxymethyllysine; Protein-specific modification},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.mappin},
pages = {420-428},
peerreviewed = {Yes},
title = {{Mapping} the glycoxidation product {Nepsilon}-carboxymethyllysine in the milk proteome},
volume = {11},
year = {2011}
}
@article{faucris.213167411,
abstract = {In the human pathogenic mold Aspergillus fumigatus, sexual identity is determined by the mating-type idiomorphs MAT1-1 and MAT1-2 residing at the MAT locus. Upon crossing of compatible partners, a heterothallic mating is executed to eventually form cleistothecia that contain recombinant ascospores. Given that the MAT1 gene products are DNA binding master regulators that govern this complex developmental process, we monitored the MAT1-driven transcriptomes of A. fumigatus by conditional overexpression of either MAT1 gene followed by RNA-seq analyses. Numerous genes related to the process of mating were found to be under transcriptional control, such as pheromone production and recognition. Substantial differences between the MAT1-1- and MAT1-2-driven transcriptomes could be detected by functional categorization of differentially expressed genes. Moreover, a significant and distinct impact on expression of genetic clusters of secondary metabolism became apparent, which could be verified on the product level. Unexpectedly, specific cross-regulation of the fumagillin/pseurotin supercluster was evident, thereby uncoupling its co-regulatory characteristic. These insights imply a tight interconnection of sexual development accompanied by ascosporogenesis with secondary metabolite production of a pathogenic fungus and impose evolutionary constraints that link these two fundamental aspects of the fungal lifestyle.
},
author = {Yu, Yidong and Blachowicz, Adriana and Will, Christine and Szewczyk, Edyta and Glenn, Steven and Gensberger-Reigl, Sabrina and Nowrousian, Minou and Wang, Clay C. C. and Krappmann, Sven},
doi = {10.1111/mmi.14136},
faupublication = {yes},
journal = {Molecular Microbiology},
note = {EVALuna2:36418},
pages = {1045-1065},
peerreviewed = {Yes},
title = {{Mating}-type factor-specific regulation of the fumagillin/pseurotin secondary metabolite supercluster in {Aspergillus} fumigatus},
volume = {110},
year = {2018}
}
@article{faucris.239351557,
abstract = {Traces of lipids, absorbed and preserved for millennia within the
inorganic matrix of ceramic vessels, act as molecular fossils and
provide manifold information about past people’s subsistence, diet,
and rituals. It is widely assumed that lipids become preserved
after adsorption into nano- to micrometer-sized pores, but to
this day the distribution of these lipids in the ceramics was virtually
unknown, which severely limits our understanding about the
process of lipid preservation. Here we use secondary ion mass
spectrometry (SIMS) imaging for direct in situ analysis of lipids
absorbed in 700- to 2,000-y-old archaeological pottery. After sectioning
from larger sherds, wall cross-sections of smaller fragments
were used for SIMS analysis. Lipids were found in
relatively large zones of 5- to 400-μm diameter, which does not
support the notion of absorption only into individual nanometerscale
pores but indicates that more macroscopic structures in the
ceramics are involved in lipid preservation as well. Furthermore,
lipids were found concentrated on calcium carbonate inclusions in
the ceramics, which suggests that precipitation of fatty acids as
calcium salts is an important aspect of lipid preservation in archaeological
samples. This has important implications for analytical
methods based on extraction of lipids from archaeological ceramics
and needs to be considered to maximize the yield and available
information from each unique sample.
s1-casein was carried out by ultrahigh-performance liquid chromatography–electrospray ionization tandem mass spectrometry with scheduled multiple reaction monitoring (UHPLC–ESI–MS/MS–sMRM). Analysis of defatted and regular raw milk samples after heating for up to 8 min at 120 °C and analysis of ultrahigh-temperature milk samples with 0.1%, 1.5%, and 3.5% fat revealed that methionine oxidation of the five residues of the whey proteins and of residues M 123, M 135, and M 196 of αs1-casein was not affected or even suppressed in the presence of milk fat. Only the oxidation of residues M 54 and M 60 of αs1-casein was promoted by lipids. In evaporated milk samples, formation of methionine sulfoxide was hardly influenced by the fat content of the samples. Thus, it can be concluded that lipid oxidation products are not the major cause of methionine oxidation in milk.},
author = {Wüst, Johannes and Pischetsrieder, Monika},
doi = {10.1039/c5fo01550b},
faupublication = {yes},
journal = {Food and Function},
pages = {2526-2536},
peerreviewed = {Yes},
title = {{Methionine} sulfoxide profiling of milk proteins to assess the influence of lipids on protein oxidation in milk},
volume = {7},
year = {2016}
}
@article{faucris.230230187,
abstract = {Ergosterol is the major sterol in button mushrooms (Agaricus bisporus)
and can occur as free alcohol or esterified with fatty acids
(ergosteryl esters). In this study, gas chromatography with mass
spectrometry in the selected ion monitoring mode (GC/MS-SIM) was used to
determine ergosterol and ergosteryl esters as well as other sterols and
steryl esters in button mushrooms. Different quality control measures
were established and sample preparation procedures were compared to
prevent the formation of artifacts and the degradation of ergosteryl
esters. The final method was then used for the determination of
ergosterol (443 ± 44 mg/100 g dry matter (d.m.)) and esterified
ergosterol (12 ± 6 mg/100 g d.m.) in button mushroom samples (n =
4). While the free sterol fraction was vastly dominated by ergosterol
(∼90% of five sterols in total), the steryl ester fraction was more
diversified (nine sterols in total, ergosterol ∼55%) and consisted
primarily of linoleic acid ester},
author = {Hammann, Simon and Vetter, Walter},
doi = {10.1021/acs.jafc.6b00383},
faupublication = {no},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Mass spectrometry; Method development; Gas chromatography; Lipolysis; Sterol ester; Agaricus bisporus},
pages = {3437-3444},
peerreviewed = {Yes},
title = {{Method} development for the determination of free and esterified sterols in button mushrooms ({Agaricus} bisporus)},
url = {https://www.chemcalc.org/mf{\_}finder/mfFinder{\_}em{\_}new},
volume = {64},
year = {2016}
}
@article{faucris.113836404,
abstract = {Site-specific relative quantification of β-lactoglobulin modifications in heated milk and dairy products was performed to determine their thermal and nonthermal origins and to evaluate marker candidates for milk processing. Therefore, formation kinetics of 19 different structures at 26 binding sites were analyzed by ultrahigh-performance liquid chromatography-tandem mass spectrometry with multiple reaction monitoring (UHPLC-MS/MS/MRM) after specific protein hydrolysis. The results indicate that (i) site-specific analysis of lactulosyllysine may be a more sensitive marker for mild heat treatment than its overall content; (ii) Nε-carboxymethyllysine, N-terminal ketoamide, and asparagine deamidation are of thermal origin and may be good markers for rather intensive heat treatment, whereas Nε-carboxyethyllysine reflects thermal and nonthermal processes; (iii) the relevance of methylglyoxal-derived arginine modifications is low compared to that of other modifications; (iv) oxidation of methionine and cysteine is a rather weak indicator of thermal impact; and (v) the tryptophan modifications formylkynurenine and kynurenine are of nonthermal origin and further degraded during processing.},
author = {Meltretter, Jasmin and Wüst, Johannes and Pischetsrieder, Monika},
doi = {10.1021/jf503664y},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {heat marker; mass spectrometry; milk; protein modification; β-lactoglobulin},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.modifi},
pages = {10903-10915},
peerreviewed = {Yes},
title = {{Modified} peptides as indicators for thermal and nonthermal reactions in processed milk},
url = {http://pubs.acs.org/doi/full/10.1021/jf503664y},
volume = {62},
year = {2014}
}
@article{faucris.216717114,
abstract = {Was passiert in unserem Körper, wenn wir Kaffee trinken und warum verlieren auch oft gesunde Menschen die Kontrolle, wenn Kartoffelchips oder Schokolade locken? Die molekulare Ernährungsphysiologie versucht, die Wirkungen von Lebensmitteln definierten molekularen Inhaltsstoffen zuzuordnen. Beim Kaffee weiß man, dass und wie das Koffein uns wachhält. Auch einigen anderen Mechanismen sind die Lebensmittelchemiker auf
der Spur.
Background & aims: The effect of human milk storage in the refrigerator has been investigated with regard to sensory changes and modifications to the molecular composition of the milk odour-active volatiles.
Methods: In the present study, characteristic odorants from fat oxidation, known from previous studies, as well as free fatty acids were quantified as representative marker substances by means of stable isotope dilution assays of fresh milk samples and milk samples stored at +4 °C for one and three days, respectively.
Results: Sensory evaluation showed that rancid and sweaty odour attributes were generated during storage, resulting in an unpleasant aroma profile for adults; however, odour changes were not as pronounced as those observed in our previous study for freeze storage. Fatty and buttery odour notes and a cooked milk-like smell were also generated. In total eight odorants from fat oxidation were determined and some potent odorants showed slight concentration increases. Moreover, five free fatty acids were determined and these all showed drastic concentration increases, even after storage for just one day.
Conclusions: These investigations support our previous findings that storage recommendations for breast milk might need to be slightly reconsidered in view of potential sensory changes; on the other hand, no negative physiological effects are to be expected from these changes.
Keywords: Fatty acid oxidation; Human milk; Polyunsaturated fatty acid (PUFA); Quantification; Stable isotope dilution assays (SIDA); Storage at +4 °C.
},
author = {Spitzer, Johanna and Klos, Katharina and Büttner, Andrea},
doi = {10.1016/j.clnu.2013.01.015},
faupublication = {yes},
journal = {Clinical Nutrition},
pages = {1036-1042},
peerreviewed = {Yes},
title = {{Monitoring} aroma changes during human milk storage at +4°{C} by sensory and quantification experiments.},
year = {2013}
}
@article{faucris.112980164,
abstract = {Background & aims: The effect of human milk storage in the refrigerator has been investigated with regard to sensory changes and modifications to the molecular composition of the milk odour-active volatiles. Methods: In the present study, characteristic odorants from fat oxidation, known from previous studies, as well as free fatty acids were quantified as representative marker substances by means of stable isotope dilution assays of fresh milk samples and milk samples stored at+4°C for one and three days, respectively. Results: Sensory evaluation showed that rancid and sweaty odour attributes were generated during storage, resulting in an unpleasant aroma profile for adults; however, odour changes were not as pronounced as those observed in our previous study for freeze storage. Fatty and buttery odour notes and a cooked milk-like smell were also generated. In total eight odorants from fat oxidation were determined and some potent odorants showed slight concentration increases. Moreover, five free fatty acids were determined and these all showed drastic concentration increases, even after storage for just one day. Conclusions: These investigations support our previous findings that storage recommendations for breast milk might need to be slightly reconsidered in view of potential sensory changes; on the other hand, no negative physiological effects are to be expected from these changes. © 2013 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism.},
author = {Spitzer, Johanna and Klos, Katharina and Büttner, Andrea},
doi = {10.1016/j.clnu.2013.01.015},
faupublication = {yes},
journal = {Clinical Nutrition},
keywords = {Fatty acid oxidation; Human milk; Polyunsaturated fatty acid (PUFA); Quantification; Stable isotope dilution assays (SIDA); Storage at+4°C},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.monito{\_}0},
pages = {doi: 10.1016/j.clnu.2013.01.015},
peerreviewed = {Yes},
title = {{Monitoring} aroma changes during human milk storage at +4°{C} by sensory and quantification experiments},
year = {2013}
}
@article{faucris.257898111,
author = {Heinlein, Anja and Büttner, Andrea},
doi = {10.1039/C2FO30061C},
faupublication = {yes},
journal = {Food and Function},
pages = {1059-1067},
peerreviewed = {unknown},
title = {{Monitoring} of biotransformation of hop aroma compounds in an in vitro digestion model.},
year = {2012}
}
@article{faucris.210344324,
abstract = {The phenethylamine alkaloid hordenine, present in germinated barley, was identified recently as a functionally selective dopamine D2 receptor agonist contributing potentially to the rewarding effects of drinking beer. Here, it was shown that the hordenine precursor N-methyltyramine binds with a similar affinity to the dopamine D2 receptor as hordenine (K-i 31.3 mu M) showing also selectivity towards the G protein-mediated pathway over the beta-arrestin pathway. Using a newly developed UHPLC-ESI-MS/MS method to monitor beer production, we demonstrated that hordenine and N-methyltyramine were released continuously from barley malt during mashing and were stable during fermentation and conditioning. The amounts released from different base malt types were in a similar range but tended to be higher from caramel malts. Hordenine and N-methyltyramine concentrations in 24 types of beer varied between 1.05-6.32 and 0.59-4.61 mg/L, respectively. Thus, the human uptake of the alkaloids during beer consumption is in the low milligram range.},
author = {Sommer, Thomas and Dlugash, Gelena and Hübner, Harald and Gmeiner, Peter and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2018.10.067},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Beer;Brewing;Dopamine D2 receptor agonist;Fermentation;Hordenine;Mashing;N-Methyltyramine},
pages = {745-753},
peerreviewed = {Yes},
title = {{Monitoring} of the dopamine {D2} receptor agonists hordenine and {N}-methyltyramine during the brewing process and in commercial beer samples},
volume = {276},
year = {2019}
}
@article{faucris.107009144,
abstract = {In this study, highly monodispersed spherical bioactive glass nanoparticles (BGS) with a particle size of 408 $±$ 36 nm were synthesized using a modified Stöber method. The BGS was then functionalized with lysozyme (LY) via a simple electrostatic interaction routine under selected conditions. The LY-functionalized BGS (LY-BGS) exhibited monodispersity, spherical morphology and homogeneity in size. The incorporated content of LY could be tailored conveniently by adjusting the initial concentration of the LY precursor for functionalization. Hydroxyapatite (HA) formed on the LY-BGS after soaking in simulated body fluid (SBF) for 7 d, but the formation was retarded compared to the non-functionalized BGS. The LY-BGS showed antibacterial activity towards Gram-positive B. subtilis and >90% of the bacteria was killed within 24 h after culture with the LY-BGS at a concentration of 1 mg ml$-$1. The LY-BGS also showed cytotoxicity towards the human hepatocellular carcinoma (HepG2) cell line. In addition, the relative cytotoxicity increased with an increase in the concentration of the LY-BGS in contact with the cells. As a comparison, the LY-BGS exhibited reduced or no cytotoxicity towards human umbilical vein endothelial cells (HUVECs) at the same concentration with respect to the HepG2 groups. Notably, the relative cell viability of HepG2 was 45.9% after exposure to the LY-BGS at a concentration of 10 \textgreekmg ml$-$1 for 24 h, while no decrease in relative viability for the HUVECs was observed under the same conditions. This cytotoxicity window between cancerous cells and healthy cells could be expected for cancer treatment. Furthermore, the antibacterial properties and the bioactivity of LY-BGS make it a promising material for biomedical applications, particularly in the treatment of bone defects caused by tumors.},
author = {Zheng, Kai and Lu, Miao and Liu, Yufang and Chen, Qiang and Taccardi, Nicola and Hueser, Norbert and Boccaccini, Aldo R.},
doi = {10.1088/1748-6041/11/3/035012},
faupublication = {yes},
journal = {Biomedical Materials},
keywords = {antibacterial activity; anticancer activity; bioactive glasses; lysozyme; nanocomposites},
peerreviewed = {Yes},
title = {{Monodispersed} lysozyme-functionalized bioactive glass nanoparticles with antibacterial and anticancer activities},
volume = {11},
year = {2016}
}
@article{faucris.230230537,
abstract = {Tocopherols and tocotrienols
(usually summed up as vitamin E) are a class of structurally related
natural antioxidants. Commonly, only some of the eight classic
representatives (four tocopherols and four tocotrienols) are found with
varied composition in food. In this study we fractionated 230 mg oil
from commercial vitamin E supplement capsules by countercurrent
chromatography (CCC) and subsequent analysis by gas chromatography with
mass spectrometry (GC/MS) of silylated CCC fractions showed that these
eight isomers represented only about 70% of total tocopherol compounds.
Detailed analysis enabled the detection of 161 T3 isomers (α-, γ- and δ-T3)
along with 18 tetra- and several penta-unsaturated isomers (tocools),
two tocomonoenol isomers, and several degradation products with shorter
isoprenoid side chain (apo-tocools). Altogether, over 170 tocool
compounds, most likely artefacts which originated from an inappropriate
oil refining process were described in this study. Silver ion high
performance liquid chromatography (Ag+-HPLC) was used to separate one fraction rich in γ-T3 into four peaks each consisting of at least five peaks according to GC/MS. About ten γ-T3 isomers were also detected in rice bran oils from one producer bought retail in Germany.
},
author = {Hammann, Simon and Kröpfl, Alexander and Vetter, Walter},
doi = {10.1016/j.chroma.2016.11.018},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {Countercurrent chromatography; Tocomonoenol; Tocotrienol; GC/MS; Rice bran oil; Vitamin E capsule},
pages = {77-87},
peerreviewed = {Yes},
title = {{More} than 170 polyunsaturated tocopherol-related compounds in a vitamin {E} capsule: {Countercurrent} chromatographic enrichment, gas chromatography/mass spectrometry analysis and preliminary identification of the potential artefacts},
url = {https://www.sciencedirect.com/science/article/pii/S0021967316315102},
volume = {1476},
year = {2016}
}
@article{faucris.112386384,
abstract = {The use of advanced glycation end-products (AGEs) as biomarkers for diagnosis and clinical studies is still hampered by insufficient knowledge on clinically relevant structures formed from precursors associated with defined disease states. The present study conducted untargeted analysis of the glycating activity of AGE-precursors by ultrahigh performance liquid chromatography/ tandem mass spectrometry multiple reaction monitoring (UHPLC/MSMS-MRM), monitoring the loss of a nonapeptide as the glycation target. Thus, the glycating activities of seven important AGE-precursors were determined (glucose 13% and the reactive carbonyl compounds glucosone 39%, 3-deoxyglucosone 15%, 3-deoxygalactosone 26%, 3,4-dideoxyglucosone-3-ene 79%, methylglyoxal 94%, and glyoxal 97% peptide loss; 12 h/37 °C). Furthermore, UHPLC/MSMS with simultaneous precursor ion scan and information-dependent acquisition of enhanced resolution spectra and subsequent product ion scan was applied for untargeted analysis of the major AGE-structures derived from various AGE-precursors. The 20 most important modifications could be assigned to 8 AGE-structures previously reported in the literature. Seven loosely bound AGEs not yet covered by conventional methods were detected and assigned to hemiaminals. Five AGE structures did not match any known products. The method can be applied to analyze glycating activity and AGE-structures formed from various other precursors under defined reaction conditions, supporting the selection and evaluation of diagnostic AGE-markers for clinical studies. © 2011 American Chemical Society.},
author = {Mittelmaier, Stefan and Pischetsrieder, Monika},
doi = {10.1021/ac2025706},
faupublication = {yes},
journal = {Analytical Chemistry},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.multis},
pages = {9660-9668},
peerreviewed = {Yes},
title = {{Multistep} ultrahigh performance liquid chromatography/tandem mass spectrometry analysis for untargeted quantification of glycating activity and identification of most relevant glycation products},
url = {http://pubs.acs.org/articlesonrequest/AOR-S4utDcgCXUj68E6g9juD},
volume = {83},
year = {2011}
}
@article{faucris.117921364,
abstract = {Spreading transmissible spongiform encephalopathies (TSE) have been widely attributed to transmission by ingestion of mammalian central nervous system (CNS) tissue. Reliable exclusion of this epidemiological important route of transmission relies on an effective surveillance of food contamination. Here, myelin proteolipid protein (PLP) is identified as a specific and largely heat-resistant marker for detection of food contaminations by CNS tissue. PLP is a component of oligodendritic glial sheaths of neuronal processes that is specifically expressed in the CNS. A highly selective polyclonal antibody was developed directed against an epitope present in the full-length PLP protein, but absent from the developmentally regulated splice variant DM-20. In combination with a hydrophobic extraction of PLP from tissue samples, the antibody reliably detected PLP from spinal cord, cerebellum, and cortex of different mammalian species. Consistent with earlier reports on PLP expression, no cross-reactivity was observed with peripheral nerve or extraneural tissue, except for a very faint signal obtained with heart. When applied to an artificial CNS contamination present in sausages, the antibody reliably detected a low concentration (1%) of the contaminant. Application of heat, as used during conventional sausage manufacturing, led to a predominant alteration of arginine residues in the PLP protein and a partial loss of immunoreactivity. In contrast, a stretch of hydrophilic amino acids112-122 proved to be heat-resistant, preserving the immunogenicity of this PLP epitope during heating. Taken together, the excellent CNS specificity of PLP immunodetection and the presence of a heat-resistant epitope have permitted the development of a highly sensitive immunoassay for CNS contamination in routine food control. © 2007 American Chemical Society.},
author = {Villmann, Carmen and Sandmeier, Barbara and Seeber, Silke and Hannappel, Ewald and Pischetsrieder, Monika and Becker, Cord-Michael},
doi = {10.1021/jf0707278},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {CNS; Food contamination; Myelin proteolipid protein; Polyclonal antibody},
note = {UnivIS-Import:2015-04-14:Pub.2007.nat.dchph.llmch.myelin},
pages = {7114-7123},
peerreviewed = {Yes},
title = {{Myelin} {Proteolipid} {Protein} ({PLP}) as a {Marker} {Antigen} of {Central} {Nervous} {System} {Contaminations} for {Routine} {Food} {Control}},
volume = {55},
year = {2007}
}
@article{faucris.110725384,
abstract = {N2-(1-Carboxyethyl)deoxyguanosine (CEdG) is a major nonenzymatic glycation product of DNA. The effect of CEdG modification, which was specifically prepared by incubation with dihydroxyacetone, on plasmid DNA topology was evaluated by gel electrophoresis. A time-dependent decrease of supercoiled plasmid-DNA was observed in parallel to the increase of CEdG adducts; the half-life time of the supercoiled plasmid-DNA was estimated to be approximately 16-18 h. CEdG-modified plasmid DNA showed a 25-fold re duced transformation efficiency. When modified DNA was used to transform Escherichia coli cells, a 6-fold increase in mutation frequency was determined by measuring loss of alpha-complementation. For the mutator strain BMH71-18mutS, an 8-fold increase in mutation frequency was observed. Although the exact mechanism of DNA damage is unclear, the occurrence of spontaneous depurination is likely. These findings suggest that a defined DNA glycation reaction can lead to DNA damage in vivo.},
author = {Pischetsrieder, Monika and Seidel, Wolfgang and Münch, Gerald and Schinzel, Reinhard},
doi = {10.1006/bbrc.1999.1528},
faupublication = {yes},
journal = {Biochemical and Biophysical Research Communications},
note = {UnivIS-Import:2015-03-05:Pub.1999.nat.dchph.llmch.n21car},
pages = {544-549},
peerreviewed = {Yes},
title = {{N2}-(1-{Carboxyethyl})deoxyguanosine, a nonenzymatic glycation adduct of {DNA} induces single strand breaks and increases mutation frequencies},
volume = {264},
year = {1999}
}
@article{faucris.120930084,
abstract = {Advanced glycation end product (AGE)-mediated modification of proteins is enhanced both in the kidneys and aortas of diabetic and uremic patients. However, AGE modification of deoxyribonucleic acid (DNA) has not yet been reported in these patients. We performed immunohistochemistry of kidneys and aortas using a monoclonal antibody against N2-carboxyethyl-2′- deoxyguanosine (CEdG), a marker of AGE-linked DNA. A total of 20 kidneys and 20 aortas were obtained by autopsy. The kidney samples consisted of two groups: nondiabetic nonkidney disease (control) and diabetic nephropathy. The aorta samples consisted of four groups: nondiabetic nonkidney disease (control), diabetes, hemodialysis, and diabetic hemodialysis. In the kidneys CEdG was detected predominantly in the nuclei of epithelial cells, mesangial cells, and endothelial cells of the glomeruli, parietal epithelial cells, and tubular cells. The number of CEdG-positive cells in the glomeruli was significantly increased in diabetic nephropathy compared with control. In the aortic walls, CEdG was detected predominantly in the nuclei of macrophages and myofibroblasts. The number of CEdG-positive cells in the aorta was significantly increased in hemodialysis patients and diabetic hemodialysis patients compared with control. The highest number of CEdG-positive cells in the aorta was observed in diabetic hemodialysis patients. In conclusion, AGE-mediated modification of DNA is enhanced in the kidney of diabetic nephropathy and the aorta of uremic atherosclerosis, and may induce a loss of genetic integrity in these diseases. © 2006 International Society of Nephrology.},
author = {Li, H. and Nakamura, Sakurako and Miyazaki, Shigeru and Morita, T. and Suzuki, M. and Pischetsrieder, Monika and Niwa, Toshimitsu},
doi = {10.1038/sj.ki.5000064},
faupublication = {yes},
journal = {Kidney International},
keywords = {Advanced glycation end products; Aorta; Diabetes; Hemodialysis; Kidney; N},
note = {UnivIS-Import:2015-03-09:Pub.2006.nat.dchph.llmch.ncarbo},
pages = {388-392},
peerreviewed = {Yes},
title = {{N²}-carboxyethyl-2'-deoxyguanosine, a {DNA} glycation marker, in kidneys and aortas of diabetic and uremic patients},
volume = {69},
year = {2006}
}
@article{faucris.110725604,
abstract = {Recent studies suggested that interruption of the interaction of advanced glycation end products (AGEs), with the signal-transducing receptor receptor for AGE (RAGE), by administration of the soluble, extracellular ligand-binding domain of RAGE, reversed vascular hyperpermeability and suppressed accelerated atherosclerosis in diabetic rodents. Since the precise molecular target of soluble RAGE in those settings was not elucidated, we tested the hypothesis that predominant specific AGEs within the tissues in disorders such as diabetes
and renal failure, Ne-(carboxymethyl)lysine (CML) adducts, are ligands of RAGE. We demonstrate here that physiologically relevant CML modifications of proteins engage cellular RAGE, thereby activating key cell signaling pathways such as NF-kB and modulating gene
expression. Thus, CML-RAGE interaction triggers processes intimately linked to accelerated vascular and inflammatory complications that typify disorders in which inflammation is an established component.},
author = {Kislinger, Thomas and Fu, Caifeng and Huber, Birgit and Qu, Wu and Taguchi, Akihiko and Yan, Shi Du and Hofmann, Marion A. and Yan, Shi Fang and Pischetsrieder, Monika and Stern, David M. and Schmidt, Ann Marie},
doi = {10.1074/jbc.274.44.31740},
faupublication = {yes},
journal = {Journal of Biological Chemistry},
note = {UnivIS-Import:2015-03-05:Pub.1999.nat.dchph.llmch.ncarbo},
pages = {31740-31749},
peerreviewed = {unknown},
title = {{N} -({Carboxymethyl})lysine adducts of proteins are ligands for {RAGE} (receptor for {AGE}) that activate cell signalling pathways and modulate gene expression},
volume = {274},
year = {1999}
}
@article{faucris.281699503,
abstract = {Cereal cultivation in Britain dates back to ca. 4000 BCE, probably introduced by migrant farmers from continental Europe. Widespread evidence for livestock appears in the archaeozoological record, also reflected by ubiquitous dairy lipids in pottery organic residues. However, despite archaeobotanical evidence for domesticated plants (such as cereals), organic residue evidence has been near-absent. Our approach, targeting low-abundance cereal-specific markers, has now revealed evidence for cereals (indicating wheat) in Neolithic pottery from Scottish 'crannogs', dating to ca. 3600 - 3300 BCE. Their association with dairy products suggests cereals may have been regularly prepared together as a milk-based gruel. We also observed a strong association between the occurrence of dairy products and smaller-mouthed vessels. Here, we demonstrate that cereal-specific markers can survive in cooking pots for millennia, revealing the consumption of specific cereals (wheat) that are virtually absent from the archaeobotanical record for this region and illuminating culinary traditions among early farming communities.},
author = {Hammann, Simon and Bishop, Rosie R. and Copper, Mike and Garrow, Duncan and Greenwood, Caitlin and Hewson, Lanah and Sheridan, Alison and Sturt, Fraser and Whelton, Helen L. and Cramp, Lucy J.E.},
doi = {10.1038/s41467-022-32286-0},
faupublication = {yes},
journal = {Nature Communications},
note = {CRIS-Team Scopus Importer:2022-09-16},
peerreviewed = {Yes},
title = {{Neolithic} culinary traditions revealed by cereal, milk and meat lipids in pottery from {Scottish} crannogs},
volume = {13},
year = {2022}
}
@article{faucris.120930304,
author = {Bronowicka, Agneta and Laechelin, J. and Pischetsrieder, Monika and Franke, Peter},
faupublication = {yes},
journal = {Deutsche Lebensmittel-Rundschau},
note = {UnivIS-Import:2015-03-09:Pub.2006.nat.dchph.llmch.neueas},
pages = {185-191},
peerreviewed = {Yes},
title = {{Neue} {Aspekte} im {Lebensmittelhygienerecht}: {Die} {Verordnung} ({EG}) {Nr}. 852/2004 über {Lebensmittelhygiene} - neue {Vorschriften} für die {Produktion} von {Lebensmitteln}?},
volume = {102},
year = {2006}
}
@inproceedings{faucris.121960344,
abstract = {Craving for special types of food like snack food can tremendously influence our energy balance. The result: obesity due to a non-homeostatic, hedonic food intake, i.e. an intake of energy independent of hunger and satiety. The intake of potato chips – an often craved highly palatable snack food – has a great influence on whole brain activity pattern. Especially the reward system as well as circuits regulating food intake, sleep and locomotor activity are affected. Furthermore, we could show that the fat and carbohydrate content is a main contributor to the palatability of potato chips. These first steps of the identification of the molecular triggers and the corresponding effects on brain activity pattern of the non-homeostatic intake of highly palatable snack food are reviewed in this chapter.},
address = {Washington, DC},
author = {Hoch, Tobias and Heß, Andreas and Pischetsrieder, Monika},
booktitle = {The Chemical Sensory Informatics of Food: Measurement, Analysis, Integration},
doi = {10.1021/bk-2015-1191.ch010},
faupublication = {yes},
isbn = {9780841230699},
note = {UnivIS-Import:2015-07-08:Pub.2015.nat.dchph.llmch.nonhom},
pages = {119-131},
peerreviewed = {Yes},
publisher = {ACS},
title = {{Non}-homeostatic intake of snack foods: {Molecular} triggers and effects on brain activity pattern},
venue = {Washington, DC},
volume = {1191},
year = {2015}
}
@article{faucris.229749456,
abstract = {The aim of this work was to evaluate the partially purified protease of sour orange flower extract (OFR) by determining the protein profile and milk-clotting activity as well as chemical and sensory characteristics of cheese throughout 45 days of ripening. Three rennets were used to produce cheeses, (1) the sour orange flower rennet at a level of 0.2 g/L milk (OFR), (2) standard calf rennet at a level of 0.02 g/L milk (CR), and (3) OFR (0.1 g/L)/CR (0.01 g/L). OFR cheese acidity was higher compared to that of the calf rennet (CR) and OFR/CR (50:50) samples. Significantly (p < 0.05) higher proteolytic activity was observed in OFR cheese through measuring the soluble nitrogen (SN), non-protein nitrogen (NPN), and total free amino acids (FAA) content. Protein profiles of cheeses determined with SDS-PAGE also confirmed higher levels of casein hydrolysis in OFR cheese. Reversed-phase high-performance liquid chromatography revealed the noticeable qualitative and quantitative differences between peptide profiles of all treatments. Higher casein degradation and production of peptide plus amino acids in OFR and OFR/CR cheeses suggested faster and more intensive ripening. The flavor and texture acceptance scores were reduced on the last day of storage in OFR cheese, while OFR/CR cheese received the highest score for flavor. In conclusion, the blend of OFR/CR may be regarded as an alternative for calf rennet in white brined cheese production which accelerates ripening process and causes development of a unique flavor in the final product.},
author = {Nasiri, Elham and Hesari, Javad and Shekarforoush, Seyed Shahram and Azadmard Damirchi, Sodeif and Gensberger-Reigl, Sabrina and Pischetsrieder, Monika},
doi = {10.1007/s00217-019-03403-z},
faupublication = {yes},
journal = {European Food Research and Technology},
keywords = {Protease; Ripening; Sour orange flowers; White brined cheese},
month = {Jan},
note = {CRIS-Team Scopus Importer:2019-11-26},
pages = {139-148},
peerreviewed = {Yes},
title = {{Novel} milk-clotting enzyme from sour orange flowers ({Citrus} aurantium {L}.) as a coagulant in {Iranian} white cheese},
volume = {246},
year = {2020}
}
@article{faucris.115205024,
abstract = {In the healthy gut, NF-kB is a critical factor of the intestinal immune system, whereas inflammatory bowel diseases are associated with chronic activation of NF-kB. Previous studies indicated that coffee induces nuclear translocation of NF-kB in macrophages, an effect attributed to roasting products. In the present work, coffee extract or roasting products induced nuclear translocation of NF-kB in macrophages, Caco-2 cells, and primary human intestinal microvascular endothelial cells (up to fivefold, p < 0.001). Since the effect clearly depended on the cell type, ex vivo experiments were performed with intact human gut tissue from biopsies. The uniformity of the specimens and tissue viability during ex vivo incubation for up to 2 h were verified. Roasting products led to a concentration dependent significant increase of nuclear translocation of NF-kB in human gut tissue (up to 2.85 fold increase, p ¼ 0.0321), whereas coffee extract induced a trend towards higher nuclear NF-kB concentration. NF-kB activation
in macrophages and Caco-2 cells by roasting products was significantly blocked by co-incubation with catalase (p=0.011 and p=0.024) indicating involvement of H2O2-signaling. Monitoring of extracellular H2O2 indicated that roasting products in coffee constantly generate H2O2 by spontaneous oxygen reduction, which is only partially detoxified by cellular antioxidative systems. Thus, it can be concluded that ex vivo stimulation of intact human gut tissue is a valuable model to study nutritional effects on complex tissue systems. Furthermore, the consumption of coffee and roasting products may be able to induce nuclear NF-kB translocation in the human gut.},
author = {Sauer, Tanja and Raithel, Martin and Kressel, Jürgen and Muscat, Sonja and Münch, Gerald and Pischetsrieder, Monika},
doi = {10.1039/c1fo10055f},
faupublication = {yes},
journal = {Food and Function},
note = {UnivIS-Import:2015-04-14:Pub.2011.nat.dchph.llmch.nuclea},
pages = {529-540},
peerreviewed = {Yes},
title = {{Nuclear} translocation of {NF}-{kappaB} in intact human gut tissue upon stimulation with coffee and roasting products},
volume = {2},
year = {2011}
}
@article{faucris.111613304,
abstract = {Background: Controlled randomised studies to prove improved cardiovascular stability and improved anaemia management during on-line haemodiafiltration (oHDF) are scarce. Methods: 70 patients were treated with both haemodialysis (HD) and oHDF in a cross-over design during 2 x 24 weeks at a dialysis dose of eKt/ V ≥ 1.2. Patients randomised into group A started on HD and switched over to oHDF, whereas patients in group B began with oHDF and were treated with HD afterwards. Intradialytic morbid events (IME), such as symptomatic hypotension or muscle cramps, were noted in case of appearance. Blood parameters reflecting anaemic status, phosphate status, lipid metabolism, oxidative stress, and accumulation of advanced glycation end products were recorded either monthly or at the end of each study phase. Results: The mean incidence of IME was 0.15 IME per treatment, and there was no statistical difference between oHDF and HD. A higher haematocrit (oHDF 31.5% vs. HD 30.5%, p < 0.01) at a lower erythropoietin dose (oHDF 4,913 vs. HD 5,492 IU/week, p = 0.02) was found during oHDF, when the sequence of HD and oHDF had not been taken into account. For the study groups, the results were less distinct: in group A, a higher haematocrit (HD 30.4% vs. oHDF 32.0%, p < 0.01) at a comparable erythropoietin dose (HD 5,421 vs. oHDF 5,187 IU/week, ns) was observed during oHDF, whereas in group B an identical haematocrit (oHDF 30.8% vs. HD 30.7%, ns) was achieved at a reduced erythropoietin dose (oHDF 4,622 vs. HD 5,568 IU/week, p < 0.01). During oHDF, lower levels of free and protein-bound pentosidine and of serum phosphate were found. Conclusion: In contrast to other studies, no benefit regarding cardiovascular stability for oHDF was found, but oHDF could well offer a potential benefit regarding anaemia correction, inflammation, oxidative stress, lipid profiles, and calcium-phosphate product. Copyright © 2006 S. Karger AG.},
author = {Vaslaki, Lajos and Major, Lajos and Berta, Klara and Karatson, Andras and Misz, Mihay and Pethoe, Ferenc and Ladanyi, Erzebet and Fodor, Bertalan and Stein, Günter and Pischetsrieder, Monika and Zima, Thomas and Wojke, Ralf and Gauly, Adelheid and Passlick-Deetjen, Jutta},
doi = {10.1159/000090117},
faupublication = {yes},
journal = {Blood Purification},
keywords = {Anaemia; Erythropoietin; Haematocrit; Haemodialysis; oHDF and high-flux HD, comparison; On-line haemodiafiltration; Pentosidine; Phosphate},
note = {UnivIS-Import:2015-03-09:Pub.2006.nat.dchph.llmch.online},
pages = {163-173},
peerreviewed = {Yes},
title = {{On}-line haemodiafiltration versus haemodialysis: stable haematocrit with less erythropoietin and improvement of other relevant blood parameters},
volume = {24},
year = {2006}
}
@article{faucris.298874802,
abstract = {In this study, the encapsulation of Chlorella vulgaris by spray drying was optimized by Simplex-Lattice mixture design using different wall materials such as aquafaba, deactivated baker's yeast, inulin and maltodextrin in different ratios. This is the first study in which novel and innovative wall materials such as aquafaba, and deactivated baker's yeast are used for drying and encapsulation of C. vulgaris biomass. Model responses were highly dependent on wall material ratios; encapsulation yield (38.9 %–78.4 %), chlorophyll-a encapsulation efficiency (EE) (35.8 %–98.9 %), and total carotenoid EE (52.0 %–98.8 %). In addition, physicochemical characteristics including pH, moisture content, crude protein content, chlorophyll-a concentration, total carotenoid concentration, water activity, color [a*, b*, L*, chroma (C*), and hue angle (h°)], wettability, and hygroscopicity were determined to characterize the encapsulation process. Both chlorophyll-a and total carotenoid EEs of the samples including 25 % (m/m) microalgae and 75 % (m/m) deactivated baker's yeast were determined to be >90 %. The optimal feed composition for spray drying was determined as 25 % algae with 75 % deactivated yeast.},
author = {Tamtürk, Faruk and Gürbüz, Başak and Toker, Ömer Said and Dalabasmaz, Sevim and Malakjani, Narjes and Durmaz, Yaşar and Konar, Nevzat},
doi = {10.1016/j.algal.2023.103115},
faupublication = {yes},
journal = {Algal Research},
keywords = {Aquafaba; Chlorella vulgaris; Deactivated baker's yeast; Optimization; Spray drying},
note = {CRIS-Team Scopus Importer:2023-05-05},
peerreviewed = {unknown},
title = {{Optimization} of {Chlorella} vulgaris spray drying using various innovative wall materials},
volume = {72},
year = {2023}
}
@article{faucris.230985042,
author = {Gensberger-Reigl, Sabrina and Konopa, Andreas},
faupublication = {yes},
journal = {Deutsche Lebensmittel-Rundschau},
note = {CRIS-Team WoS Importer:2020-01-03},
pages = {444-450},
peerreviewed = {Yes},
title = {{Optimization} of {Cleaning} {Processes} based on the quantitative {Analysis} of {Chlorate}},
volume = {115},
year = {2019}
}
@article{faucris.114056184,
abstract = {Kefir has a long tradition in human nutrition due to its presupposed health promoting effects. To investigate the potential contribution of bioactive peptides to the physiological effects of kefir, comprehensive analysis of the peptide profile was performed by nano-ESI-LTQ-Orbitrap MS coupled to nano-ultrahigh-performance liquid chromatography. Thus, 257 peptides were identified, mainly released from β-casein, followed by αS1-, κ-, and αS2-casein. Most (236) peptides were uniquely detected in kefir, but not in raw milk indicating that the fermentation step does not only increase the proteolytic activity 1.7- to 2.4-fold compared to unfermented milk, but also alters the composition of the peptide fraction. The influence of the microflora was determined by analyzing kefir produced from traditional kefir grains or commercial starter culture. Kefir from starter culture featured 230 peptide sequences and showed a significantly, 1.4-fold higher proteolytic activity than kefir from kefir grains with 127 peptides. A match of 97 peptides in both varieties indicates the presence of a typical kefir peptide profile that is not influenced by the individual composition of the microflora. Sixteen of the newly identified peptides were previously described as bioactive, including angiotensin-converting enzyme (ACE)-inhibitory, antimicrobial, immunomodulating, opioid, mineral binding, antioxidant, and antithrombotic effects. Biological significance: The present study describes a comprehensive peptide profile of kefir comprising 257 sequences. The peptide list was used to identify 16 bioactive peptides with ACE-inhibitory, antioxidant, antithrombotic, mineral binding, antimicrobial, immunomodulating and opioid activity in kefir. Furthermore, it was shown that a majority of the kefir peptides were not endogenously present in the raw material milk, but were released from milk caseins by proteases of the microbiota and are therefore specific for the product. Consequently, the proteolytic activity and the composition of the peptide profile can be controlled by the applied microflora (grains or starter culture). On the other hand, a considerable portion of the peptide profile was identified to be typical for kefir in general and independent from production parameters.In summary, the generated kefir peptide profile helped to reveal its origin and to identify bioactive peptides in kefir, which may advance the understanding of health benefits of this food product. The results further indicate that subsets of the kefir peptide list can be used as markers to control food authenticity, for example, to distinguish different types of kefir.},
author = {Ebner, Jennifer and Asci Arslan, Ayse and Fedorova, Maria and Hoffmann, Ralf and Kücükcetin, Ahmet and Pischetsrieder, Monika},
doi = {10.1016/j.jprot.2015.01.005},
faupublication = {yes},
journal = {Journal of Proteomics},
keywords = {Bioactive peptides; Caseins; Kefir; Nano-ESI-LTQ-Orbitrap MS; Peptide profiling; Starter culture},
note = {UnivIS-Import:2015-03-09:Pub.2015.nat.dchph.llmch.peptid},
pages = {41-57},
peerreviewed = {Yes},
title = {{Peptide} profiling of bovine kefir reveals 236 unique peptides released from caseins during its production by starter culture and kefir grains},
volume = {117},
year = {2015}
}
@incollection{faucris.238319616,
abstract = {Peptides are important food components with bioactive properties
(including, e.g., antimicrobial, antioxidative, ACE-inhibitory or
anticariogenic effects) and technological function. By now, targeted and
untargeted mass spectrometry, mainly MALDI-TOF-MS and LC–ESI-high
resolution MS/MS, allow for the comprehensive analysis of the peptide
composition in food. Food peptidomics or food peptide profiling are
crucial techniques to identify and quantify bioactive peptides in food
and to understand the influence of peptides on food quality.
Bioinformatic tools facilitate linking peptide structures and functions.
Additionally, peptide profiles can complement the analytical toolbox to
assure food authenticit},
address = {Oxford},
author = {Dalabasmaz, Sevim and Pischetsrieder, Monika},
booktitle = {Comprehensive Foodomics},
doi = {10.1016/B978-0-08-100596-5.22757-1},
editor = {Cifuentes, A.},
faupublication = {yes},
isbn = {9780128163955},
keywords = {ACE-Inhibitory activity; Antimicrobial activity; Antioxidative activity; Bioactive peptides; Food authentication; LC–MS/MS; MALDI-TOF-MS; Milk products; Peptide databases; Peptide profile; Peptidomics; Phosphopeptides; Quantification.
Targeted analysis
Untargeted analysis},
pages = {651-665},
peerreviewed = {Yes},
publisher = {Elsevier B.V.},
series = {Reference Module in Food Sciences.},
title = {{Peptidomics} in {Food}},
volume = {1},
year = {2020}
}
@article{faucris.257425869,
abstract = {Characterisation of food-flavour release using quadrupole-based on-line mass spectrometers such as proton-transfer-reaction mass spectrometry (PTR-MS, or PTR-QMS) can be complicated when nominally isobaric aroma compounds are present in complex food matrices. The recent combination of PTR-MS with time-of-flight mass spectrometry (PTR-TOF-MS) offers an analytical tool potentially capable of overcoming this problem because of its enhanced mass resolution. In this context, four pairs of isobaric compounds (cis-3-hexenol and 2,3-pentanedione, benzaldehyde and m-xylene, ethyl butanoate and 2-methylbutanol, and isobutyl isopentanoate and 1-hexanol) were investigated by PTR-TOF-MS to assess its mass-resolving power for food-flavour applications. Headspace analyses of aqueous solutions containing nominally isobaric aroma compounds that are unresolvable by PTR-QMS demonstrated that the PTR-TOF-MS mass-resolving power, which is m/z-dependent, enabled discrimination between isobaric peaks at a centre of mass separation down to at least 0.030 Da. Visual discrimination between these isobaric compound peaks in the headspace of aqueous solutions down to a concentration range of a few tens of ng mL−1 was also possible, enabling an empirical method for determining the limit of quantitation in solution for single compounds. PTR-TOF-MS offers distinct advantages over conventional PTR-MS for certain flavour release applications.
-1 was also possible, enabling an empirical method for determining the limit of quantitation in solution for single compounds. PTR-TOF-MS offers distinct advantages over conventional PTR-MS for certain flavour release applications. © 2013 Elsevier Ltd.},
author = {Zardin, Erika and Tyapkova, Oxana and Büttner, Andrea and Beauchamp, Jonathan},
doi = {10.1016/j.lwt.2013.10.041},
faupublication = {yes},
journal = {Lwt-Food Science and Technology},
keywords = {Flavour release; Isobaric compounds; Limit of quantitation; PTR-TOF-MS},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.perfor},
pages = {153-160},
peerreviewed = {Yes},
title = {{Performance} assessment of proton-transfer-reaction time-of-flight mass spectrometry ({PTR}-{TOF}-{MS}) for analysis of isobaric compounds in food-flavour applications},
volume = {56},
year = {2014}
}
@article{faucris.121075284,
abstract = {Purpose: Post-synaptic dopamine D2/3 receptors are reduced in animal models of obesity, and in obese humans, concordant with similar findings in habitual drug users. However, corresponding pre-synaptic changes in brain dopamine are less documented in obesity models. Therefore, we used positron emission tomography (PET) with the dopamine transporter (DAT) ligand N-(3-[18F]fluoropropyl)-2-β-carbomethoxy-3-β-(4′-methylphenyl) tropane ([18F]FP-CMT) to test the hypothesis that DAT availability is attenuated in adult fatty Zucker (FZ) rats versus lean littermates (LZ).},
author = {Cumming, Paul and Maschauer, Simone and Riss, Patrick and Grill, Eva and Pischetsrieder, Monika and Kuwert, Torsten and Prante, Olaf},
doi = {10.1007/s11307-014-0811-7},
faupublication = {yes},
journal = {Molecular Imaging and Biology},
keywords = {Dopamine transporters; DAT; Positron emission tomography; Striatum; Obesity; Zucker rats},
note = {UnivIS-Import:2015-04-14:Pub.2014.nat.dchph.llmch.pertub},
pages = {521-528},
peerreviewed = {Yes},
title = {{Perturbed} development of striatal dopamine transporters in fatty versus lean {Zucker} rats: a follow-up small animal {PET} study},
volume = {17},
year = {2015}
}
@article{faucris.203405110,
abstract = {Phosphoglucose isomerase (PGI) is a key enzyme in early glycolysis, which
catalyzes the reversible isomerization of glucose 6-phosphate (G6Ph) to fructose
6-phosphate. We have constructed an Escherichia coli K12 strain with a
deleted pgi gene (Δpgi ) and shown that this strain in comparison with the parental
strain 1) accumulates higher amount of G6Ph, 2) grows slowly, and 3)
exhibits higher spontaneous mutation frequency to rifampicin resistance
(Rifr), when grown on high glucose minimal medium. Intriguingly, the spontaneous
mutation rate to Rifr was inversely related to the degree of E. coli
chromosomal DNA modification with sugar derivatives. We measured higher
concentrations of Amadori products, fluorophores (360 nm excitation/440
nm emission) and carboxymethyl residues in the chromosomal DNA of the E.
coli parental strain than in DNA of the isogenic Δpgi strain. To explain this
apparent paradox we hypothesized that PGI might be implicated in repair of
G6Ph-derived lesions in DNA. In favor of our hypothesis, we further demonstrate
that protein extract from the E. coli PGI proficient strain but not from
the PGI deficient strain catalyzes the release of G6Ph from G6Ph-modified
single stranded DNA oligonucleotide and from its hybrid duplex with a complementary
peptide nucleic acid.
2R) ligands MS308, BM138, quinpirole, and sulpiride in an in vitro D2R transfection model. Quantification of 14,160 phosphosites revealed a low impact of the partial G protein agonist MS308 on cellular protein phosphorylation, as well as surprising similarities between the balanced agonist quinpirole and the inverse agonist sulpiride. Analysis of the temporal profiles of ligand-induced phosphorylation events showed a transient impact of the G protein-selective agonist MS308, whereas the β-arrestin-preferring agonist BM138 elicited a delayed, but more pronounced response. Functional enrichment analysis of ligand-impacted phosphoproteins and treatment-linked kinases confirmed multiple known functions of D2R signaling while also revealing novel effects, for example of MS308 on sterol regulatory element-binding protein-related gene expression. All raw data were deposited in MassIVE (MSV000089457).},
author = {Wenk, Deborah and Khan, Shahbaz and Ignatchenko, Vladimir and Hübner, Harald and Gmeiner, Peter and Weikert, Dorothée and Pischetsrieder, Monika and Kislinger, Thomas},
doi = {10.1021/acs.jproteome.2c00707},
faupublication = {yes},
journal = {Journal of Proteome Research},
keywords = {biased signaling; dopamine D2 receptor; functional selectivity; G protein; GPCRs; phosphoproteomics; proteome analysis; quinpirole; sulpiride; β-arrestin},
month = {Jan},
note = {CRIS-Team Scopus Importer:2023-01-20},
pages = {259-271},
peerreviewed = {Yes},
title = {{Phosphoproteomic} {Analysis} of {Dopamine} {D2} {Receptor} {Signaling} {Reveals} {Interplay} of {G} {Protein}- and β-{Arrestin}-{Mediated} {Effects}},
volume = {22},
year = {2023}
}
@article{faucris.230231317,
abstract = {Phytyl fatty acid esters (PFAE) are esters of fatty acids with the isoprenoid alcohol phytol (3,7R,11R,15-tetramethylhexadec-2E-enol).
In this study, PFAE were identified and quantified in bell pepper using
gas chromatography with mass spectrometry (GC-MS). All red (n = 14) and yellow (n
= 6) samples contained six or seven PFAE at 0.9–11.2 mg/100 g fresh
weight. By contrast, PFAE were not detected in green bell pepper samples
(n = 3). PFAE might eventually be a source for bioavailable
phytol, which can be transformed into phytanic acid by humans. Phytanic
acid cannot be properly degraded by patients who suffer from Refsum’s
disease (tolerable daily intake (TDI) ≤ 10 mg of phytanic acid). The
phytol moiety of the PFAE (0.4–5.4 mg/100 g fresh weight) would
contribute up to ∼50% to the TDI with the consumption of only one
portion of bell pepper fruit pul},
author = {Krauß, Stephanie and Hammann, Simon and Vetter, Walter},
doi = {10.1021/acs.jafc.6b02645},
faupublication = {no},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {phytol; phytyl fatty acid ester; Capsicum annuum; GC-MS; Refsum's disease},
pages = {6306-6311},
peerreviewed = {Yes},
title = {{Phytyl} {Fatty} {Acid} {Esters} in the {Pulp} of {Bell} {Pepper} ({Capsicum} annuum)},
url = {https://pubs.acs.org/doi/abs/10.1021/acs.jafc.6b02645},
volume = {64},
year = {2016}
}
@article{faucris.121822184,
abstract = {Concentrations of 1- and 2-naphthol were measured in urine of 72 adults and 35 young children from Germany to assess the internal exposure to naphthalene of the general population. Naphthols could be detected in more than 90% of the urine samples. Levels of naphthols (sum of 1- and 2-naphthol) were 4-fold higher in smokers (median: 37.6 μg/g creatinine) compared to non-smoking adults (8.2 μg/g creatinine). On a creatinine basis young children had slightly lower naphthol levels in urine compared with adults (7.5 μg/g creatinine). Preliminary reference values for the sum of 1- and 2-naphthol in urine as means of the 95th percentile are proposed: 41.2 μg/g creatinine (non-smoking adults) and 23.5 μg/g creatinine (young children). It is concluded that 1- and 2-naphthol levels in urine are suitable for human biomonitoring of the naphthalene exposure in environmental medicine.},
author = {Preuß, Ralf and Koch, Holger and Wilhelm, Michael and Pischetsrieder, Monika and Angerer, Jürgen},
doi = {10.1078/1438-4639-00313},
faupublication = {yes},
journal = {International Journal of Hygiene and Environmental Health},
keywords = {Adults; Biological monitoring; Children; Environmental medicine; Metabolites; Naphthalene; Naphthol; Urine},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.pilots},
pages = {441-445},
peerreviewed = {Yes},
title = {{Pilot} study on the naphthalene exposure of {German} adults and children by means of urinary 1- and 2-naphthol levels},
volume = {207},
year = {2004}
}
@article{faucris.106335504,
abstract = {Pomegranate (Punica granatum L.) phenolic compounds may prevent oxidative stress-induced neurodegenerative diseases. The present study investigated cytoprotective effects of pomegranate wine extracts and their phenolic compounds in neuroblastoma cells SH-SY5Y. The extracts significantly activated nuclear factor erythroid 2-related factor 2 (Nrf2; ≤2.6-fold) and inhibited nuclear factor κB (NF-κB) nuclear translocation (≥26% activity) without cytotoxic effects. Moreover, pomegranate wine extract time-dependently elevated heme oxygenase-1 (HO-1) expression (≤2.9-fold) and promoted superoxide dismutase (SOD) activity (≤1.4-fold), while it had no significant effect on glutathione peroxidase (GPx) activity. The main phenolic components of the extracts, gallic acid, ellagic acid, and punicalagin also led to a significant inhibition of NF-κB and the activation of Nrf2 translocation and subsequent increase of HO-1 expression and SOD activity, dependent on concentration and incubation time. Thus, pomegranate wine and its phenolic components may have a protective effect on neuronal cells by triggering Nrf2 and inhibiting NF-κB signaling.},
author = {Li, Xuan and Liu, Linwei and Pischetsrieder, Monika},
doi = {10.1016/j.jff.2017.08.048},
faupublication = {yes},
journal = {Journal of Functional Foods},
keywords = {Pomegranate (Punica granatum L.); polyphenols; neuroblastoma cell; Nrf2; antioxidant enzyme},
pages = {140-150},
peerreviewed = {Yes},
title = {{Pomegranate} ({Punica} granatum {L},) wine polyphenols affect {Nrf2} activation and antioxidant enzyme expression in human neuroblastoma cells ({SH}-{SY5Y})},
volume = {38},
year = {2017}
}
@article{faucris.111462164,
abstract = {Sugar degradation products are formed during heat treatment of food as well as endogenously in vivo. As reactive carbonyl compounds, they react readily with proteins or DNA to form protein- or DNA-bound advanced glycation end products (glycation reaction or Maillard reaction). In this study, we investigated the formation of potential DNA-protein cross-link products from sugar degradation products. 2′-Deoxyguanosine, l-lysine and different carbohydrates were incubated at 37 °C. The sugar degradation products dihydroxyacetone and d,l-glyceraldehyde lead to the formation of two new cross-link products. The new compounds were isolated by preparative high-performance liquid chromatography and identified by spectral data as the two diastereomers of N 6-[2-(N 2-2′-deoxyguanosyl) propionyl]lysine. In this structure, the ε-amino group of lysine and the exocyclic amine group of 2′-deoxyguanosine are linked via a carboxyethyl group, derived from the carbohydrate component. The binding sites and the binding types were confirmed by synthesis of the analogous products from N 2-(1-carboxyethyl)guanosine and N α -acetyllysine methyl ester. © Springer-Verlag 2005.},
author = {Peich, Carlo and Seidel, Wolfgang and Hanak, Nicole and Waibel, Reiner and Schneider, Marc and Pischetsrieder, Monika},
doi = {10.1007/s00217-005-1145-0},
faupublication = {yes},
journal = {European Food Research and Technology},
keywords = {2′-Deoxyguanosine; Advanced glycation end products; Dihydroxyacetone; DNA-protein cross-link; Glyceraldehyde; N ; Sugar degradation products},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.llmch.potent},
pages = {9-13},
peerreviewed = {Yes},
title = {{Potential} {DNA}-protein cross-link products formed by sugar degradation products: identification of {N6}-[2-({N²}-2'-deoxyguanosyl)propionyl]lysine},
volume = {221},
year = {2005}
}
@article{faucris.117377964,
abstract = {The use of the preservative and potential allergen hen egg white lysozyme in cheese production has to be declared. In the present study, an HPLC method with fluorescence detection (HPLC-FLD) was optimised and validated for the analysis of lysozyme in cheese. Lysozyme was detected in concentrations between 30.8 and 386.2 mg/kg cheese in 30 out of 46 analysed commercial cheese samples. During cheese production and storage for 0-54 weeks a lysozyme satellite peak (LSP) was detected, which totals up to 18% of the lysozyme content. Mass spectrometry and peptide mass fingerprint revealed that LSP possesses the same primary structure as lysozyme. Since disulphide scrambling could not be detected, LSP was assigned to a conformational isomer of lysozyme. As a consequence, LSP was included in the HPLC-FLD analysis of lysozymes in cheese. © 2011 Elsevier Ltd. All rights reserved.},
author = {Schneider, Nadine and Werkmeister, Knut and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1016/j.foodchem.2011.03.010},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Cheese; Fluorescence detection; Hen egg white lysozyme; HPLC; Lysozyme degradation},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.preval},
pages = {145-151},
peerreviewed = {Yes},
title = {{Prevalence} and stability of lysozyme in cheese},
volume = {128},
year = {2011}
}
@article{faucris.288439454,
abstract = {Bioactive peptides, released from buttermilk by fermentation and/or gastrointestinal proteases, may have health promoting effects. Thus, a comprehensive analysis of the peptide fraction of fermented buttermilk, before and after different phases of simulated gastrointestinal digestion, was performed using ultra high-performance liquid chromatography-electrospray ionization-tandem mass spectrometry (UHPLC-ESI-MS/MS). Results showed that digestion simulation substantially changed the peptide profile of fermented buttermilk. A total of 81, 120 and 46 peptides were identified in fermented buttermilk, its gastric and intestinal digests, respectively. These peptides released mostly from β-casein followed by αs1-casein, κ-casein and β-lactoglobulin. In addition, 14 peptides released from milk fat globule membrane proteins (lactadherin, butyrophilin and GlyCAM-1). Bioactivity, mainly angiotensin converting enzyme (ACE) inhibitory activity, has been reported before for only 54 of the detected peptides. Radical scavenging, ferric reducing and ACE inhibitory activities of fermented buttermilk peptides increased significantly after digestion, indicating promotion in fermented buttermilk-peptide bioactivity by gastrointestinal digestion.
s1-casein.
After simulated gastrointestinal digestion,
MALDI-TOF-MS analysis detected eight putative phosphopeptides in kefir; four of
which were assigned by UHPLC–ESI–MS/MS to αs2-casein124-133,
αs2-casein137-146, β-casein30-40,
and κ-casein147-161. These results indicate that kefir is a good
dietary source of multiphosphorylated peptide},
author = {Savastano, Maria Luisa and Liu, Yufang and Ebner, Jennifer and Dittrich, Daniel and Haus, Sabrina and Gensberger-Reigl, Sabrina and Pischetsrieder, Monika},
doi = {10.1021/acsomega.8b03105},
faupublication = {yes},
journal = {ACS Omega},
keywords = {casein phosphopeptides; gastrointestinal digestion; kefir; MALDI-TOF-MS; pSpSpSEE; UHPLC–ESI–MS/MS},
pages = {7963-7970},
peerreviewed = {Yes},
title = {{Profiling} of multiphosphorylated peptides in kefir and their release during simulated gastrointestinal digestion},
url = {https://pubs.acs.org/doi/10.1021/acsomega.8b03105},
volume = {4},
year = {2019}
}
@article{faucris.230231667,
abstract = {Fatty acids of microalgae have been studied as potential chemotaxonomic
markers, to reveal plausible lipid phycotoxins or in the context of mass
production of algal biofuels. The planctonic microalgae Alexandrium tamarense (Dinophyceae) is a common harmful algal bloom species that often proliferates in eutrophic costal waters. Alexandrium
blooms are the proximal source of toxins associated with paralytic
shellfish poisoning (PSP), a neurological affliction that has caused
human illness for centuries via consumption of contaminated shellfish.
However, data on the fatty acid composition of A. tamarense is currently limited. For this reason, we cultivated a well-defined strain of A. tamarense
(Alex2, group I, North American clade) in order to study both its major
and minor fatty acids. The harvested microalgae were transesterified
and the fatty acid methyl esters were fractionated by means of
high-speed counter-current chromatography (HSCCC). The resulting 31
HSCCC fractions were analyzed by gas chromatography with mass
spectrometry (GC/MS). Unknown substances were identified by transferring
assorted HSCCC fractions into picolinyl or pyrrolidide derivatives.
Twenty fatty acids (range 0.2–22.9% contribution to total fatty acids)
were identified in the unfractionated sample with 14:0, 16:0, 18:1n-9, 18:4n-3, 18:5n-3 and 22:6n-3 representing > 80%
of the total fatty acids. HSCCC fractionation enabled the
identification of further 22 trace fatty acids contributing between
∼0.01 and 0.2% to total fatty acids. The fatty acids included several
branched-chain fatty acids as well as scarcely reported fatty acids like
11-methyl-18:1n-6tr or 18:2Δ4,9. In order to enable a better
comparability and repeatability of HSCCC fractionations, we calculated
for each HSCCC fraction the total volume of mobile phase, which had
passed the HSCCC. From this volume we subtracted the volume of extruded
stationary phase and divided the corrected volume by the total coil
volume. These elution values were in good agreement with the partition
ratios of randomly chosen fatty acid methyl esters obtained in shake
flask tests, which allows the prediction of the elution from the HSCCC
system when the partition ratio is know},
author = {Hammann, Simon and Tillmann, Urban and Schröder, Markus and Vetter, Walter},
doi = {10.1016/j.chroma.2013.08.090},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {Alexandrium tamarense; High-speed counter-current chromatography; Mass spectrometry; Fatty acid analysis; Gas chromatography},
pages = {93-103},
peerreviewed = {Yes},
title = {{Profiling} the fatty acids from a strain of the microalgae {Alexandrium} tamarense by means of high-speed counter-current chromatography and gas chromatography coupled with mass spectrometry},
url = {https://www.sciencedirect.com/science/article/pii/S0021967313013769},
volume = {1312},
year = {2013}
}
@article{faucris.120144904,
abstract = {The proteome is the totality of proteins present in a biological sample. In contrast to the static genome, the proteome is highly dynamic, influenced by the genome and many external factors, such as the state of development, tissue type, metabolic state, and various interactions. Thus, the proteome reflects very closely the biological (and chemical) processes occurring in a system. For proteome analysis, gel based and shotgun methods are most widely applied. Because of the potential to generate a systematic view of protein composition and biological as well as chemical interactions, the application of proteome analysis in food science is steadily growing. This tutorial review introduces several fields in food science, where proteomics has been successfully applied: analysis of food composition, safety assessment of genetically modified food, the search for marker proteins for food authentication, identification of food allergens, systematic analysis of the physiological activity of food, analysis of the effects of processing on food proteins and the improvement of food quality. © 2009 The Royal Society of Chemistry.},
author = {Pischetsrieder, Monika and Bäuerlein, Rainer},
doi = {10.1039/b817898b},
faupublication = {yes},
journal = {Chemical Society Reviews},
note = {UnivIS-Import:2015-03-09:Pub.2009.nat.dchph.llmch.proteo},
pages = {2600-2608},
peerreviewed = {Yes},
title = {{Proteome} research in food science},
volume = {38},
year = {2009}
}
@article{faucris.120814144,
abstract = {The histamine receptors (HRs) represent a subclass of G protein-coupled receptors (GPCRs) and comprise four subtypes. Due to their numerous physiological and pathological effects, HRs are popular drug targets for the treatment of allergic reactions or the regulation of gastric acid secretion. Hence, an understanding of the functional selectivity of HR ligands has gained importance. These ligands can bind to specific GPCRs and selectively activate defined pathways. Supporting the activation of a therapeutically necessary pathway without the activation of other signaling cascades can result in drugs with more specific activity and fewer side effects. To evaluate the cellular consequences resulting from receptor binding, comprehensive analyses of cellular protein alterations upon incubation with ligands are required. For this purpose, endothelial cells are treated with histamine, as the endogenous ligand of HRs, to obtain a global overview of its cellular effects. Quantitative proteomics and pathway analyses of histamine-treated and untreated cells reveal enrichment of the nuclear factor-B and tumor necrosis factor signaling pathways, cytokine-cytokine receptor interactions, complement and coagulation cascades, and acute inflammatory processes upon histamine treatment. This strategy offers the opportunity to monitor HR-mediated signaling in a multidimensional manner.},
author = {Emirbayer, Pelin Esma and Sinha, Ankit and Ignatchenko, Vladimir and Hoyer, Stefanie and Dörrie, Jan and Schaft, Niels and Pischetsrieder, Monika and Kislinger, Thomas},
doi = {10.1002/pmic.201700116},
faupublication = {yes},
journal = {Proteomics},
keywords = {histamine;label-free quantification;parallel reaction monitoring;secretome;Shotgun proteomics},
peerreviewed = {Yes},
title = {{Proteomic} {Response} of {Human} {Umbilical} {Vein} {Endothelial} {Cells} to {Histamine} {Stimulation}},
volume = {17},
year = {2017}
}
@article{faucris.116630184,
abstract = {Background. We have demonstrated that pyridoxal 50-phosphate (PLP), an active form of vitamin B6, inhibits formation of advanced glycation end-products (AGEs) by trapping 3-deoxyglucosone. The present study aimed to clarify if PLP could exert beneficial
effects on nephropathy in diabetic rats.
Methods. Streptozotocin (STZ)-induced diabetic rats were treated by oral administration of PLP or pyridoxamine (PM), another active form of vitamin B6, at a dose of 600 mg/kg/day for 16 weeks. AGEs [imidazolone, Ne-(carboxymethyl)lysine (CML) and N2-carboxyethyl-20-deoxyguanosine (CEdG)], transforming growth factor-b1 (TGF-b1), type 1 collagen
and fibronectin were detected in the kidneys using immunohistochemistry. Gene expression of TGF-b1 and receptor for AGEs (RAGEs) in the kidneys was determined using real-time quantitative polymerase chain reaction.
Results. Administration of PLP significantly inhibited albuminuria, glomerular hypertrophy, mesangial expansion, and interstitial fibrosis as compared with diabetic rats. PLP markedly inhibited accumulation of AGEs such as imidazolone, CML and CEdG, a DNAlinked
AGE, in glomeruli. PLP significantly inhibited expression of TGF-b1, type 1 collagen, fibronectin and RAGE in the kidneys. PLP was superior to PM in inhibiting accumulation of AGEs, expression of TGF-b1, type 1 collagen, and fibronectin, and the development of diabetic nephropathy.
Conclusions. PLP prevented progression of nephropathy in STZ-induced diabetic rats by inhibiting formation of AGEs. PLP is considered a promising active form of vitamin B6 for the treatment of AGElinked disorders such as diabetic nephropathy.},
author = {Nakamura, Sakurako and Li, Hongyan and Adijiang, Ayinuer and Pischetsrieder, Monika and Niwa, Toshimitsu},
doi = {10.1093/ndt/gfm166},
faupublication = {yes},
journal = {Nephrology Dialysis Transplantation},
keywords = {advanced glycation end-products (AGEs); diabetic nephropathy; pyridoxal 50-phosphate (PLP); receptor for advanced glycation end-products (RAGE); transforming growth factor-b1 (TGF-b1)},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.pyrodi},
pages = {2165-2174},
peerreviewed = {Yes},
title = {{Pyrodixal} phosphate prevents progression of diabetic nephropathy},
volume = {22},
year = {2007}
}
@article{faucris.120091884,
abstract = {The nonenzymatic reaction between reducing sugars and proteins, known as the Maillard reaction, has received increased recognition from nutritional science and medical research. The development of new analytical techniques for the detection of protein-bound Maillard products is therefore crucial. In this study, we applied peptide mapping by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry to investigate the formation of structurally specific Maillard products on glycated lysozyme (AGE-lysozyme), produced upon incubation with D-glucose. In parallel, we synthesized Nε-(carboxymethyl)lysine-modified lysozyme (CML-lysozyme) and Nε-(carboxyethyl)lysine-modified lysozyme, two well-described glycation products, as model substances. 3-Deoxyglucosone-modified lysozyme and methylglyoxal-modified lysozyme were prepared as examples of glycation products incubated with dicarbonyl compounds. We were able to detect specific modifications on AGE-lysozyme, which were assigned to CML, imidazolone A, and the Amadori product.},
author = {Humeny, Andreas and Kislinger, Thomas and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1021/jf011349o},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Imidazolone A; Maillard reaction; MALDI-TOF-MS peptide mapping; N; Protein glycation},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.qualit},
pages = {2153-2160},
peerreviewed = {Yes},
title = {{Qualitative} {Determination} of {Specific} {Protein} {Glycation} {Products} by {Matrix}-{Assisted} {Laser} {Desorption}/{Ionization} {Mass} {Spectrometry} {Peptide} {Mapping}},
url = {http://pubs.acs.org/reprint-request?jf011349o/L6jS},
volume = {50},
year = {2002}
}
@article{faucris.120092324,
abstract = {Matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS) was used to qualitatively study the formation of early Maillard products of lysozyme, produced upon incubation with seven different sugars (D-ribose, L-rhamnose, D-glucose, D-fructose, D-galactose, D-lactose, D-maltose) in solution, in the presence of oxygen. MALDI-TOF mass
spectra of intact lysozyme revealed a heterogeneous distribution of glycation products, detected by significant mass increase and peak broadening. Therefore, to get more detailed information about the nature of the glycation products, we performed MALDI-TOF MS peptide mapping analysis. In each of the peptide mapping spectra we were able to detect the early glycation products (Amadori products/glucosylamines) with high selectivity. We were able to distinguish between the Amadori products of the different sugars, due to the characteristic mass increases of the glycated peptides. Furthermore, variations of the modification pattern were observed,
very likely due to the different relativities of the seven reducing sugars. Other, more advanced glycation products of the initially formed Maillard products were also detected. Further studies regarding the nature of these late Maillard products are in progress. Here we report,
for the first time, the use of MALDI-TOF MS peptide mapping as a quick and highly selective method for the detection of early stage Maillard products produced upon incubation of lysozyme with seven different reducing sugars.},
author = {Kislinger, Thomas and Humeny, Andreas and Seeber, Silke and Peich, Carlo and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1007/s00217-002-0491-4},
faupublication = {yes},
journal = {European Food Research and Technology},
keywords = {Maillard reaction; Amadori products; MALDI-TOF MS peptide mapping},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.qualit{\_}2},
pages = {65-71},
peerreviewed = {Yes},
title = {{Qualitative} {Determination} of the {Early} {Maillard}-{Products} by {MALDITOF} {Mass} {Spectrometry} {Peptide} {Mapping}},
volume = {215},
year = {2002}
}
@article{faucris.106944684,
abstract = {Heat sterilization of peritoneal dialysis (PD) fluids leads to partial degradation of the osmotic agent to form reactive carbonyl structures, which significantly reduce the biocompatibility of PD fluids and impair long-term PD therapy. Hence, it is important to know the exact composition of the degradation products to improve biocompatibility of PD fluids. Our study conducted targeted screening for degradation products in polyglucose (icodextrin)-containing PD fluids (pGDPs) by applying o-phenylenediamine (OPD) to form stable derivatives, which were analyzed by ultrahigh-performance liquid chromatography with hyphenated diode array tandem mass spectrometry (UHPLC−DAD−MS/MS). For the first time, specific degradation products of polyglucose, namely, 4-deoxyglucosone (4-DG) and 3,4-dideoxypentosone (3,4-DDPS), could be identified in PD fluids. Further, a reaction product of 5-hydroxymethylfurfural (5-HMF) and OPD could be characterized to be (5-(1H-benzo[d]imidazol-2-yl)furan-2-yl)methanol. Additionally, 3-deoxyglucosone (3-DG) and 3-deoxygalactosone (3-DGal), both known to be present in glucose-based PD fluids, were also detected in polyglucose-containing fluids. Trapping a hitherto unknown degradation product with OPD yielded 1,4-bis(1H-benzo[d]imidazol-2-yl)-3,4-dihydroxybutan-1-one, which was present in heat- as well as filter-sterilized PD fluids.},
author = {Gensberger, Sabrina and Knabner, Carina and Waibel, Reiner and Huppert, Jochen and Pischetsrieder, Monika},
doi = {10.1021/acs.analchem.5b00665},
faupublication = {yes},
journal = {Analytical Chemistry},
note = {UnivIS-Import:2015-07-08:Pub.2015.nat.dchph.llmch.qualit},
pages = {6103-6111},
peerreviewed = {Yes},
title = {{Qualitative} profiling of polyglucose degradation products in peritoneal dialysis fluids},
volume = {87},
year = {2015}
}
@article{faucris.224801151,
abstract = {Endocannabinoids and endocannabinoid-related compounds (ERCs) are involved in many physiological processes.
They are released on demand from phosphoinositide and N-acylphosphatidyl ethanolamine (NAPE) precursors and comprise 2-monoacylglycerols (2-MGs) and FA ethanolamides (FEAs). Despite the abundance of advanced quantitative methods, however, their determined concentrations in blood plasma are inconsistent because 2-MGs and FEAs undergo artifactual de novo formation, chemical isomerization, and degradation during sample collection and storage. For a comprehensive survey of these compounds in blood and plasma, we have developed and validated an ultra-HPLC-MS/MS method to quantify 24 endocannabinoids, ERCs, and their phospholipid precursors. Immediate acidification of EDTA-blood to pH 5.8 blocked artifactual FEA formation for at least 4 h on ice. The 2-MGs were stabilized after plasma harvest with 0.5 M potassium thiocyanate at pH 4.7. FEA and MG plasma concentrations in six healthy volunteers ranged between 0.04-3.48 and 0.63-6.18 ng/ml, respectively. Interestingly, only 1-5% of circulating FEAs were present in their free form, while the majority was bound to NAPEs. Similarly, 97% of 2-arachidonoylglycerol (2-AG) was bound to a potential phosphoinositide pool. The herein-described stabilization and extraction methods may now be used to reliably and comprehensively quantify endocannabinoids, ERCs, and their phospholipid precursors in clinical studies.},
author = {Röhrig, Waldemar and Achenbach, Susanne and Deutsch, Birgit and Pischetsrieder, Monika},
doi = {10.1194/jlr.D094680},
faupublication = {yes},
journal = {Journal of Lipid Research},
keywords = {fatty acid ethanolamide; 2-arachidonoylglycerol; 2-monoacylglycerol; N-acylphosphatidyl ethanolamine; phosphatidyl
ethanolamine; arachidonoyl phosphoinositid; Orlistat; blood; lipases; phospholipases},
pages = {1475-1488},
peerreviewed = {Yes},
title = {{Quantification} of 24 circulating endocannabinoids, endocannabinoid-related compounds, and their phospholipid precursors in human plasma by {UHPLC}-{MS}/{MS}.},
url = {http://www.jlr.org/content/60/8/1475.full},
volume = {60},
year = {2019}
}
@article{faucris.211633596,
abstract = {Hop β-bitter acids (lupulones) are health-beneficial components of Humulus lupulus L. showing, for example, antidepressant-like effects in vitro.
Despite of the widespread use of hops for medicinal purposes, the
concentrations of lupulones in hop-based drugs have not been reported
yet. The present study developed, validated, and applied a method with
external calibration, which allows for the first time separate
quantification of co-, n-, and ad-lupulone in hop-based drugs by
UHPLC‒DAD. Concentrations between ‘not detectable’ and 2.7 mg/mL
co-lupulone, 2.2 mg/mL nlupulone, or 0.7 mg/mL ad-lupulone were measured
in nine different commercial dietary supplements and
phytopharmaceuticals. Only one hop tincture contained sufficient
lupulone to possibly exert potential antidepressant effects. Aiming for
products with increased lupulone content, the extraction efficiency of
different solvents was investigated. Complete extraction of lupulones
from raw hops was achieved by organic solvents including methanol and
ethanol, whereas aqueous mixtures resulted in low recovery. These
results indicate that adapted extraction conditions may result in more
effective hops product},
author = {Schulz, Carolin and Chiheb, Chafia and Pischetsrieder, Monika},
doi = {10.1016/j.jpba.2019.02.022},
faupublication = {yes},
journal = {Journal of Pharmaceutical and Biomedical Analysis},
keywords = {β-bitter acids; dietary supplements; hops; lupulones; phytopharmaceuticals; UHPLC-DAD.},
pages = {124-132},
peerreviewed = {Yes},
title = {{Quantification} of co-, n-, and ad-lupulone in hop-based dietary supplements and phytopharmaceuticals and modulation of their contents by the extraction method},
url = {https://authors.elsevier.com/a/1Ycds2cNmgK3VN},
volume = {168},
year = {2019}
}
@article{faucris.114274864,
abstract = {During heat sterilization of peritoneal dialysis (PD) fluids, the glucose component is partially degraded. The formed glucose degradation products impair biocompatibility and limit the long-term application of PD fluids. As an alternative to glucose, icodextrin, a polyglucose, is used as osmotic agent in PD fluids. After targeted screening for reactive carbonyl compounds, NMR- and MS-analyses very recently revealed 4-deoxyglucosone (4-DG), 3-deoxyglucosone (3-DG), 3-deoxygalactosone (3-DGal), 3,4-dideoxypentosone (3,4-DDPS), and 5-hydroxymethylfurfural (5-HMF) as main polyglucose degradation products (pGDPs) in icodextrin-based PD fluids. Now, the present study established and validated a UHPLC method with DAD as well as a UHPLC-MS/MS method for the first-time quantification of those five major pGDPs in commercial icodextrin PD fluids after derivatization with o-phenylenediamine. Thus, 4-DG was identified to be the main degradation product (in concentrations up to 20 mu M). In contrast to the values measured in glucose-based products, the concentration of 3-DGal (<= 16 mu M) was higher than the concentration of 3-DG (<= 7 mu M) indicating different reaction pathways starting from polyglucose compared to glucose. The compounds 3,4-DDPS and 5-HMF were present in minor quantities (<= 0.3 mu M each). (c) 2015 Elsevier B.V. All rights reserved.},
author = {Gensberger-Reigl, Sabrina and Huppert, Jochen and Pischetsrieder, Monika},
doi = {10.1016/j.jpba.2015.10.022},
faupublication = {yes},
journal = {Journal of Pharmaceutical and Biomedical Analysis},
keywords = {Icodextrin; Polyglucose degradation products; 4-Deoxyglucosone (4-DG); alpha-Dicarbonyl compound; 3,4-Dideoxypentosone (3,4-DDPS); Peritoneal dialysis},
month = {Jan},
pages = {132-138},
peerreviewed = {Yes},
title = {{Quantification} of reactive carbonyl compounds in icodextrin-based peritoneal dialysis fluids by combined {UHPLC}-{DAD} and -{MS}/{MS} detection},
volume = {118},
year = {2016}
}
@article{faucris.112388144,
abstract = {During heat sterilization of peritoneal dialysis solutions, glucose is partially transformed into glucose degradation products (GDPs), which significantly reduce the biocompatibility of these medicinal products. Targeted α-dicarbonyl screening identified glyoxal, methylglyoxal, 3-deoxyglucosone, 3,4-dideooxyglucosone-3-ene, glucosone, and 3-deoxygalactosone as the major six GDPs with α-dicarbonyl structure. In the present study, an ultra-high-performance liquid chromatography method was developed which allows the separation of all relevant α-dicarbonyl GDPs within a run time of 15 min after derivatization with o-phenylenediamine. Hyphenated diode array detection/tandem mass spectrometry detection provides very robust quantification and, at the same time, unequivocal peak confirmation. Systematic evaluation of the derivatization process resulted in an optimal derivatization period that provided maximal derivatization yield, minimal de novo formation (uncertainty range ±5%), and maximal sample throughput. The limit of detection of the method ranged from 0.13 to 0.19 μM and the limit of quantification from 0.40 to 0.57 μM. Relative standard deviations were below 5%, and recovery rates ranged between 91% and 154%, dependent on the type and concentration of the analyte (in 87 out of 90 samples, recovery rates were 100∈±∈ 15%). The method was then applied for the analysis of commercial peritoneal dialysis fluids (nine different product types, samples from three lots of each). [Figure not available: see fulltext.] © 2011 Springer-Verlag.},
author = {Mittelmaier, Stefan and Fünfrocken, Michael and Fenn, Dominik and Berlich, Robert and Pischetsrieder, Monika},
doi = {10.1007/s00216-011-5195-9},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {α-Dicarbonyl compounds; 3,4-DGE; Glucose degradation products; Peritoneal dialysis fluids; Tandem mass spectrometry; UHPLC},
note = {UnivIS-Import:2015-03-09:Pub.2011.nat.dchph.llmch.quanti},
pages = {1183-1193},
peerreviewed = {Yes},
title = {{Quantification} of the six major alpha-dicarbonyl contaminants in peritoneal dialysis fluids by {UHPLC}/{DAD}/{MSMS}},
volume = {401},
year = {2011}
}
@article{faucris.288794660,
abstract = {Certain polyunsaturated fatty acids with n-3 double bonds are essential nutrients for the human body and are part of the bilayer of cell membranes or precursors of tissue hormones. The most abundant dietary n-3 fatty acids in human nutrition are α-linolenic, eicosapentaenoic, and docosahexaenoic acid and can be taken up through dietary sources such as vegetable oils or fish or, alternatively, dietary supplements with high levels of n-3 fatty acids. In previous studies, considerable variation of lipid patterns and quantities of n-3 fatty acids were observed. In this study, 33 dietary supplements from the German market, based on fish-, krill-, microalgae, and plant oil, have been analyzed. Lipid profiling (LC–MS) revealed triacylglycerols as the dominant lipid species in most samples. However, krill oil was rich in phospholipids and samples containing fatty acid concentrates featured abundant fatty acid ethyl esters and diacylglycerols. Furthermore, total lipid profiles showed considerable variance depending on the lipid sources (e.g., fish or plant oil), which was also apparent in fatty acid analysis. The contents of n-3 fatty acids ranged between 150 and 570 mg/g capsule content (GC–MS) and vitamin E (α-tocopherol and tocopheryl acetate) were found in quantities ranging from 1.2 to 86.1 mg/g capsule content (HPLC–UV/Vis). While our analyses indicated a good agreement between labeled and present quantities of total n-3 fatty acids and vitamin E for the majority of samples, significant differences in agreement between individual fatty acids were observed, as well as frequent mismatches between declared and present vitamin E derivatives.},
author = {Zartmann, Anne and Völcker, Leon and Hammann, Simon},
doi = {10.1007/s00217-022-04193-7},
faupublication = {yes},
journal = {European Food Research and Technology},
keywords = {Dietary supplements; GC–MS; LC–MS; Lipid; PUFA; Tocopherol},
note = {CRIS-Team Scopus Importer:2023-02-03},
peerreviewed = {Yes},
title = {{Quantitative} analysis of fatty acids and vitamin {E} and total lipid profiling of dietary supplements from the {German} market},
year = {2023}
}
@article{faucris.107193724,
abstract = {The radical arylation of the phenolic side chain of tyrosine in peptides was investigated. Aryl radicals were generated from aryldiazonium salts using titanium(III) chloride as stoichiometric reductant. Due to the high selectivity with which 3-aryltyrosine derivatives were formed, this reaction type represents a new strategy for the direct functionalization of peptides.},
author = {Fehler, Stefanie and Pratsch, Gerald and Östreicher, Christiane and Fürst, Michael and Pischetsrieder, Monika and Heinrich, Markus},
doi = {10.1016/j.tet.2016.04.084},
faupublication = {yes},
journal = {Tetrahedron},
keywords = {Arylation; Diazonium; Peptide; Radical reaction; Tyrosine},
pages = {7888-7893},
peerreviewed = {Yes},
title = {{Radical} arylation of tyrosine residues in peptides},
volume = {72},
year = {2016}
}
@article{faucris.118901684,
author = {Utz, Wolfgang and Löber, Stefan and Gmeiner, Peter and Hübner, Harald},
doi = {10.1021/jm015522j},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
note = {UnivIS-Import:2015-03-09:Pub.2001.nat.dchph.lphch.ration{\_}6},
pages = {2691-2694},
peerreviewed = {Yes},
title = {{Rationally} {Based} {Efficacy} {Tuning} of {Selective} {Dopamine} {D4} {Receptor} {Ligands} {Leading} to the {Complete} {Antagonist} 2-[4-(4-{Chlorophenyl})piperazin-1-ylmethyl]pyrazolo[1,5-a]pyridine ({FAUC} 213)},
volume = {44},
year = {2001}
}
@article{faucris.120523084,
abstract = {The reaction of folic acid with reducing sugars (nonenzymatic glycation) under conditions that can occur during food processing and preparation was studied by high-performance liquid chromatography with diode array detection. N-(p-Aminobenzoyl)-L-glutamic acid, a well-established oxidation product, was detected in the reaction mixtures. Furthermore, a new product was isolated and identified as N2-[1-(carboxyethyl)]folic acid (CEF). CEF was the main product that was formed by the nonenzymatic glycation of folic acid. For preparation, N2-[1-(carboxyethyl)]folic acid was obtained in high yields when folic acid and dihydroxyacetone (DHA), a sugar degradation product, were heated at 100°C in phosphate buffer. Mixtures of folic acid and different sugars or DHA were heated under variation of reaction time and temperature, and CEF was quantified. Up to 50% of the vitamin was converted to CEF, with highest yields formed from maltose (49%) and lactose (43%).},
author = {Schneider, Marc and Klotzsche, Marcus and Werzinger, Christoph and Hegele, Jörg and Waibel, Reiner and Pischetsrieder, Monika},
doi = {10.1021/jf011042p},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Folate degradation; Folic acid; HPLC; Maillard reaction; N; Nonenzymatic glycation},
note = {UnivIS-Import:2015-03-09:Pub.2002.nat.dchph.llmch.reacti},
pages = {1647-1651},
peerreviewed = {Yes},
title = {{Reaction} of folic acid with reducing sugars and sugar degradation products},
url = {http://pubs.acs.org/reprint-request?jf011042p/M3Lv},
volume = {50},
year = {2002}
}
@article{faucris.238710750,
abstract = {The plasmas of diabetic or uremic patients and of those receiving peritoneal dialysis treatment have increased levels of the glucose-derived dicarbonyl metabolites like methylglyoxal (MGO), glyoxal (GO), and 3-deoxyglucosone (3-DG). The elevated dicarbonyl levels can contribute to the development of painful neuropathies. Here, we used stimulated immunoreactive Calcitonin Gene–Related Peptide (iCGRP) release as a measure of nociceptor activation, and we found that each dicarbonyl metabolite induces a concentration-, TRPA1-, and Ca2+-dependent iCGRP release. MGO, GO, and 3-DG were about equally potent in the millimolar range. We hypothesized that another dicarbonyl, 3,4-dideoxyglucosone-3-ene (3,4-DGE), which is present in peritoneal dialysis (PD) solutions after heat sterilization, activates nociceptors. We also showed that at body temperatures 3,4-DGE is formed from 3-DG and that concentrations of 3,4-DGE in the micromolar range effectively induced iCGRP release from isolated murine skin. In a novel preparation of the isolated parietal peritoneum PD fluid or 3,4-DGE alone, at concentrations found in PD solutions, stimulated iCGRP release. We also tested whether inflammatory tissue conditions synergize with dicarbonyls to induce iCGRP release from isolated skin. Application of MGO together with bradykinin or prostaglandin E2 resulted in an overadditive effect on iCGRP release, whereas MGO applied at a pH of 5.2 resulted in reduced release, probably due to an MGO-mediated inhibition of transient receptor potential (TRP) V1 receptors. These results indicate that several reactive dicarbonyls activate nociceptors and potentiate inflammatory mediators. Our findings underline the roles of dicarbonyls and TRPA1 receptors in causing pain during diabetes or renal disease.},
author = {Becker, Anna and Auditore, Andrea and Pischetsrieder, Monika and Meßlinger, Karl and Fleming, Thomas and Reeh, Peter and Sauer, Susanne},
doi = {10.1074/jbc.RA120.012890},
faupublication = {yes},
journal = {Journal of Biological Chemistry},
note = {CRIS-Team Scopus Importer:2020-05-26},
pages = {6330-6343},
peerreviewed = {Yes},
title = {{Reactive} dicarbonyl compounds cause {Calcitonin} {Gene}-{Related} {Peptide} release and synergize with inflammatory conditions in mouse skin and peritoneum},
volume = {295},
year = {2020}
}
@article{faucris.110878944,
abstract = {Advanced glycation end products (AGEs) and their cell surface receptor, RAGE, have been implicated in the pathogenesis of diabetic complications. Here, we studied the role of RAGE and expression of its proinflammatory ligands, EN-RAGEs (S100/calgranulins), in inflammatory events mediating cellular activation in diabetic tissue. Apolipoprotein E-null mice were rendered diabetic with streptozotocin at 6 weeks of age. Compared with nondiabetic aortas and kidneys, diabetic aortas and kidneys displayed increased expression of RAGE, EN-RAGEs, and 2 key markers of vascular inflammation, vascular cell adhesion molecule (VCAM)-1 and tissue factor. Administration of soluble RAGE, the extracellular domain of the receptor, or vehicle to diabetic mice for 6 weeks suppressed levels of VCAM-1 and tissue factor in the aorta, in parallel with decreased expression of RAGE and EN-RAGEs. Diabetic kidney demonstrated increased numbers of EN-RAGE-expressing inflammatory cells infiltrating the glomerulus and enhanced mRNA for transforming growth factor-β, fibronectin, and α1 (IV) collagen. In mice treated with soluble RAGE, the numbers of infiltrating inflammatory cells and mRNA levels for these glomerular cytokines and components of extracellular matrix were decreased. These data suggest that activation of RAGE primes cells targeted for perturbation in diabetic tissues by the induction of proinflammatory mediators.},
author = {Kislinger, Thomas and Tanji, Nozomu and Wendt, Thoralf and Qu, Wu and Lu, Yan and Ferran, Luis J. and Taguchi, Akihiko and Olson, Kim and Bucciarelli, Loredana and Goova, Mouza and Hofmann, Marion A. and Cataldegirmen, Guellue and D'Agati, Vivette and Pischetsrieder, Monika and Stern, David M. and Schmidt, Ann Marie},
faupublication = {yes},
journal = {Arteriosclerosis, Thrombosis, and Vascular Biology},
keywords = {Atherosclerosis; Diabetes; Glycation; Nephropathy; Receptor for advanced glycation end products},
note = {UnivIS-Import:2015-03-09:Pub.2001.nat.dchph.llmch.recept},
pages = {905-910},
peerreviewed = {Yes},
title = {{Receptor} for advanced glycation end products mediates inflammation and enhanced expression of tissue factor in vasculature of diabetic apolipoprotein {E} null mice},
volume = {21},
year = {2001}
}
@article{faucris.278518974,
abstract = {As of late, evidence has been emerging that the Maillard reaction (MR, also referred to as glycation) affects the structure and function of food proteins. MR induces the conformational and chemical modification of food proteins, not only on the level of IgG/IgE recognition, but also by increasing the interaction and recognition of these modified proteins by antigen-presenting cells (APCs). This affects their biological properties, including digestibility, bioavailability, immunogenicity, and ultimately their allergenicity. APCs possess various receptors that recognize glycation structures, which include receptor for advanced glycation end products (RAGE), scavenger receptors (SRs), galectin-3 and CD36. Through these receptors, glycation structures may influence the recognition, uptake and antigen-processing of food allergens by dendritic cells (DCs) and monocytes. This may lead to enhanced cytokine production and maturation of DCs, and may also induce adaptive immune responses to the antigens/allergens as a result of antigen uptake, processing and presentation to T cells. Here, we aim to review the current literature on the immunogenicity of AGEs originating from food (exogenous or dietary AGEs) in relation to AGEs that are formed within the body (endogenous AGEs), their interactions with receptors present on immune cells, and their effects on the activation of the innate as well as the adaptive immune system. Finally, we review the clinical relevance of AGEs in food allergies.},
author = {Noriega, Daniela Briceno and Zenker, Hannah and Croes, Cresci-Anne and Ewaz, Arifa and Ruinemans-Koerts, Janneke and Savelkoul, Huub F. J. and Van Neerven, R. J. Joost and Teodorowicz, Malgorzata},
doi = {10.3390/nu14020371},
faupublication = {yes},
journal = {Nutrients},
month = {Jan},
note = {CRIS-Team WoS Importer:2022-07-22},
peerreviewed = {Yes},
title = {{Receptor} {Mediated} {Effects} of {Advanced} {Glycation} {End} {Products} ({AGEs}) on {Innate} and {Adaptative} {Immunity}: {Relevance} for {Food} {Allergy}},
volume = {14},
year = {2022}
}
@article{faucris.120834384,
author = {Fragedaki, Evangelia and Nebel, Michael and Schupp, Nicole and Sebekova, Katarina and Völkel, Wolfgang and Klassen, Andre and Pischetsrieder, Monika and Frischmann, Matthias and Niwa, Toshimitsu and Vienken, Jörg and Heidland, August and Stopper, Helga},
doi = {10.1196/annals.1333.139},
faupublication = {yes},
journal = {Annals of the New York Academy of Sciences},
note = {UnivIS-Import:2015-04-16:Pub.2005.nat.dchph.llmch.reduce},
pages = {925},
peerreviewed = {Yes},
title = {{Reduced} {Circulating} {AGE} {Levels} and {Lower} {Genomic} {Damage} in {Patients} {Undergoing} {Daily} versus {Standard} {Hemodialysis}},
volume = {1043},
year = {2005}
}
@article{faucris.119989364,
abstract = {CONCLUSIONA temperature-dependent distribution of HpODE regioisomers could be shown in vegetable oils, suggesting their application as markers of lipid oxidation in oils used for short-term heating. (c) 2017 The Authors. Journal of The Science of Food and Agriculture published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry.},
author = {Pignitter, Marc and Zaunschirm, Mathias and Lach, Judith and Unterberger, Laura and Kopic, Antonio and Kessler, Claudia and Kienesberger, Julia and Pischetsrieder, Monika and Eggersdorfer, Manfred and Riegger, Christoph and Somoza, Veronika},
doi = {10.1002/jsfa.8766},
faupublication = {yes},
journal = {Journal of the Science of Food and Agriculture},
keywords = {lipid hydroperoxides;linoleic acid;heating;storage;vegetable oil},
pages = {1240-1247},
peerreviewed = {Yes},
title = {{Regioisomeric} distribution of 9-and 13-hydroperoxy linoleic acid in vegetable oils during storage and heating},
volume = {98},
year = {2018}
}
@article{faucris.120130164,
abstract = {The nonenzymatic glycation of proteins by reducing sugars, also known as the Maillard reaction, has received increasing recognition from nutritional science and medical research. In this study, we applied matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) to perform relative and simultaneous quantification of the Amadori product, which is an early glycation product, and of Nε-(carboxymethyl)lysine and imidazolone A, two important advanced glycation end products. Therefore, native lysozyme was incubated with D-glucose for increasing periods of time (1, 4, 8, and 16 weeks) in phosphate-buffered saline pH 7.8 at 50 °C. After enzymatic digestion with endoproteinase Glu-C, the N-terminal peptide fragment (m/z 838; amino acid sequence KVFGRCE) and the C-terminal peptide fragment (m/z 1202; amino acid sequence VQAWIRGCRL) were used for relative quantification of the three Maillard products. Amadori product, Nε-(carboxymethyl)lysine, and imidazolone A were the main glycation products formed under these conditions. Their formation was dependent on glucose concentration and reaction time. The kinetics were similar to those obtained by competitive ELISA, an established method for quantification of Nε-(carboxymethyl)lysine and imidazolone A. Inhibition experiments showed that coincubation with Nα-acetylargine suppressed formation of imidazolone A but not of the Amadori product or Nε-(carboxymethyl)lysine. The presence of Nα-acetyllysine resulted in the inhibition of lysine modifications but in higher concentrations of imidazolone A. o-Phenylenediamine decreased the yield of the Amadori product and completely inhibited the formation of Nε-(carboxymethyl)lysine and imidazolone A. MALDI-TOF-MS proved to be a new analytical tool for the simultaneous, relative quantification of specific products of the Maillard reaction. For the first time, kinetic data of defined products on specific sites of glycated protein could be measured. This characterizes MALDI-TOF-MS as a valuable method for monitoring the Maillard reaction in the course of food processing.},
author = {Kislinger, Thomas and Humeny, Andreas and Peich, Carlo and Zhang, Xiaohong and Niwa, Toshimitsu and Pischetsrieder, Monika and Becker, Cord-Michael},
doi = {10.1021/jf020768y},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Amadori product; Imidazolone A; Maillard reaction; MALDI-TOF-MS; N; Protein glycation},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.relati},
pages = {51-57},
peerreviewed = {Yes},
title = {{Relative} {Quantification} of {N}-({Carboxymethyl})lysine, {Imidazolone} {A}, and the {Amadori} {Product} in {Glycated} {Lysozyme} be {MALDI}-{TOF} {Mass} {Spectrometry}},
url = {http://pubs-acs.org/reprint-request?jf020768y/L4FF},
year = {2003}
}
@article{faucris.120130384,
abstract = {High levels of glucose degradation products in peritoneal dialysis fluids are believed to cause excess accumulation of advanced glycation end products (AGEs) in the peritoneum during continuous ambulatory peritoneal dialysis (CAPD) treatment, resulting in functional and structural changes in the peritoneal membrane of CAPD patients. In this study, we investigated whether AGEs, the receptor for AGE (RAGE), and growth factors are involved in deteriorating ultrafiltration (UF) capacity of the peritoneal membrane in patients on CAPD therapy. Immunohistochemical staining showed that ODI-GLC19, a novel monoclonal anti-AGE antibody, was localized exclusively in peritoneal cells, in contrast to imidazolone, localized mostly in peritoneal degenerative collagen. Numbers of ODI-GLC19– and RAGE-positive cells in the peritoneum were increased significantly in CAPD patients, even before a decrease in UF capacity, compared with patients with nonrenal disease. Cells positive for ODI-GLC19 were
identified as myofibroblasts and RAGE-positive cells and partly as CD68-positive macrophages in the peritoneum. The peritoneal membrane was thickened significantly in CAPD patients, especially patients with low UF. The number of blood vessels was increased significantly in CAPD patients with low UF. Transforming growth factor-beta1, macrophage colony-stimulating factor, and vascular endothelial growth factor were recognized in the peritoneum of CAPD patients, especially those with low UF, where imidazolone was deposited. Focal hepatocyte growth factor expression was noted in the peritoneum of patients with low UF in moderate intensity, specifically in the area without severe structural changes. In conclusion, progressive accumulation of AGEs in the peritoneum may promote peritoneal expression of various growth factors and subsequently deteriorate UF capacity in CAPD patients.},
author = {Nakamura, Sakurako and Tachikawa, Tetsuya and Tobita, Kazuki and Miyazaki, Shigeru and Sakai, Shinji and Morita, Takashi and Hirasawa, Yoshihei and Weigle, Bernd and Pischetsrieder, Monika and Niwa, Toshimitsu},
doi = {10.1053/ajkd.2003.50087},
faupublication = {yes},
journal = {American Journal of Kidney Diseases},
keywords = {Advanced glycation end products (AGEs); receptor for advanced glycation end product (RAGE); continuous ambulatory peritoneal dialysis (CAPD); peritoneum; growth factors; imidazolone.},
note = {UnivIS-Import:2015-03-09:Pub.2003.nat.dchph.llmch.roleof},
pages = {S61-S67},
peerreviewed = {Yes},
title = {{Role} of {AGEs} and growth factors in peritoneal dysfunction in {CAPD} patients},
volume = {41},
year = {2003}
}
@article{faucris.114020544,
abstract = {Oxidative and nitrosative stress resulting in mitochondria( dysfunction are an early event in the pathogenesis of Alzheimer's disease (AD). Nuclear factor erythroid-2-related factor 2 (Nrf2) is a key transcription factor and regulator of the cellular response to oxidative stress. Thus known Nrf2 activators from food materials were tested for improvement of mitochondrial membrane potential (MMP) and ATP level in neuronal pheochromocytoma cell (PC12) models of oxidative and nitrosative stress. The effects of rotenone and sodium nitroprusside (complex inhibitors of the respiratory chain) on mitochondrial function were also studied. Furthermore, Nrf2 activators were tested in human embryonic kidney cells bearing the Swedish mutation of amyloid precursor protein (APP(sw) HEK cells) as a cellular model of familial AD. Preincubation with S-allyl-L-cysteine and isoliquiritigenin increased MMP in both PC12 cell models in a similar range as the positive control L-sulforaphane. None of the test compounds, however, improved MMP and ATP level in APP(sw) HEK cells. (C) 2015 Elsevier Ltd. All rights reserved.},
author = {Denzer, Isabel and Münch, Gerald and Pischetsrieder, Monika and Friedland, Kristina},
doi = {10.1016/j.foodchem.2015.08.052},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Mitochondrial dysfunction;Oxidative stress;Nrf2;Alzheimer's disease;Aging},
pages = {843-848},
peerreviewed = {Yes},
title = {{S}-allyl-{L}-cysteine and isoliquiritigenin improve mitochondrial function in cellular models of oxidative and nitrosative stress},
volume = {194},
year = {2016}
}
@article{faucris.111765544,
abstract = {Heat treatment of dairy products leads to structural changes of proteins, which can severely decrease the nutritional value [Mauron, J. J. Nutr. Sci. Vitaminol. (Tokyo) 1990, 36(Suppl. 1), S57-69]. In this study, model solutions of the two main whey proteins, α-lactalbumin and β-lactoglobulin, respectively, were incubated with lactose, and modifications were monitored by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS). Lactulosyl residues were the most abundant modifications of α-lactalbumin and β-lactoglobulin. Up to four of these adducts were identified on the proteins. Enzymatical digest with endoproteinase AspN prior to mass spectrometric analysis allowed the detection of further modifications and their localization in the amino acid sequence. Most prominent modifications were lactulosyllysine, Nε-carboxymethyllysine, oxidation of lysine to aminoadipic semialdehyde, oxidation of methionine to methionine sulfoxide, cyclization of N-terminal glutamic acid to a pyrrolidone, and oxidation of cysteine or tryptophan. The presence of methionine oxidation was deduced from a control protein that had been oxidized by hydrogen peroxide. These studies establish MALDI-TOF-MS as a reliable tool to monitor chemical modifications of nutritional proteins during food processing. © 2007 American Chemical Society.},
author = {Meltretter, Jasmin and Seeber, Silke and Humeny, Andreas and Becker, Cord-Michael and Pischetsrieder, Monika},
doi = {10.1021/jf0705567},
faupublication = {yes},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {α-lactalbumin; β-lactoglobulin; Glycation; Maillard reaction; Matrix-assisted laser desorption/ionization mass spectrometry; Milk; Oxidation; Site specific},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.sitesp},
pages = {6096-6103},
peerreviewed = {Yes},
title = {{Site}-specific formation of {Maillard}, oxidation, and condensation products from whey proteins during reaction with lactose},
volume = {55},
year = {2007}
}
@article{faucris.203402272,
abstract = {Up to now, only a few studies about microparticle contamination of bottled mineral water have been published. The smallest analysed particle size was 5 gm. However, due to toxicological reasons, especially microparticles smaller than 1.5 mu m are critically discussed. Therefore, in the present study, 32 samples of bottled mineral water were investigated for contamination by microplastics, pigment and additive particles. Due to the application of aluminium coated polycarbonate membrane filters and micro-Raman spectroscopy, a lowest analysed particle size of 1 mu m was achieved.Microplastics were found in water from all bottle types: in single use and reusable bottles made of poly(ethylene terephthalate) (PET) as well as in glass bottles. The amount of microplastics in mineral water varied from 2649 +/- 2857 per litre in single use PET bottles up to 6292 +/- 10521 per litre in glass bottles. While in plastic bottles, the predominant polymer type was PET; in glass bottles various polymers such as polyethylene or styrene-butadiene-copolymer were found. Hence, besides the packaging itself, other contamination sources have to be considered.Pigment particles were detected in high amounts in reusable, paper labelled bottles (195047 +/- 330810 pigment particles per litre in glass and 23594 +/- 25518 pigment particles per litre in reusable paper labelled PET bottles). Pigment types found in water samples were the same as used for label printing, indicating the bottle cleaning process as possible contamination route.Furthermore, on average 708 +/- 1024 particles per litre of the additive Tris(2,4-di-tert-butylphenyl) phosphite were found in reusable PET bottles. This additive might be leached out from the bottle material itself.Over 90% of the detected microplastics and pigment particles were smaller than 5 mu m and thus not covered by previous studies. In summary, this is the first study reporting about microplastics, pigment and additive particles found in bottled mineral water samples with a smallest analysed particle size of 1 mu m. (C) 2018 Elsevier Ltd. All rights reserved.},
author = {Oßmann, Barbara and Sarau, George and Holtmannspötter, Heinrich and Pischetsrieder, Monika and Christiansen, Silke and Dicke, Wilhelm},
doi = {10.1016/j.watres.2018.05.027},
faupublication = {yes},
journal = {Water Research},
keywords = {Microplastics; Pigments; Bottled mineral water; Micro-Raman spectroscopy; Food},
pages = {307-316},
peerreviewed = {Yes},
title = {{Small}-sized microplastics and pigmented particles in bottled mineral water},
volume = {141},
year = {2018}
}
@article{faucris.107451784,
abstract = {OBJECTIVE
To elucidate the mechanisms of how snack foods may induce non-homeostatic food intake, we used resting state functional magnetic resonance imaging (fMRI), as resting state networks can individually adapt to experience after short time exposures. In addition, we used graph theoretical analysis together with machine learning techniques (support vector machine) to identifying biomarkers that can categorize between high-caloric (potato chips) vs. low-caloric (zucchini) food stimulation.
METHODS
Seventeen healthy human subjects with body mass index (BMI) 19 to 27 underwent 2 different fMRI sessions where an initial resting state scan was acquired, followed by visual presentation of different images of potato chips and zucchini. There was then a 5-minute pause to ingest food (day 1=potato chips, day 3=zucchini), followed by a second resting state scan. fMRI data were further analyzed using graph theory analysis and support vector machine techniques.
RESULTS
Potato chips vs. zucchini stimulation led to significant connectivity changes. The support vector machine was able to accurately categorize the 2 types of food stimuli with 100% accuracy. Visual, auditory, and somatosensory structures, as well as thalamus, insula, and basal ganglia were found to be important for food classification. After potato chips consumption, the BMI was associated with the path length and degree in nucleus accumbens, middle temporal gyrus, and thalamus.
CONCLUSION
The results suggest that high vs. low caloric food stimulation in healthy individuals can induce significant changes in resting state networks. These changes can be detected using graph theory measures in conjunction with support vector machine. Additionally, we found that the BMI affects the response of the nucleus accumbens when high caloric food is consume},
author = {Mendez Torrijos, Andrea and Kreitz, Silke and Ivan, Claudiu-Ionut and Konerth, Laura and Rösch, Julie and Pischetsrieder, Monika and Moll, Gunther and Kratz, Oliver and Dörfler, Arnd and Horndasch, Stefanie and Hess, Andreas},
doi = {10.1017/S1092852918000767},
faupublication = {yes},
journal = {Cns Spectrums},
keywords = {Food intake; graph theory; resting state networks; RS-fMRi; snack food; support vector machine},
pages = {1-12},
peerreviewed = {Yes},
title = {{Snack} food as a modulator of human resting-state functional connectivity.},
year = {2018}
}
@article{faucris.117646364,
abstract = {Snack food like potato chips substantially contributes to energy intake in humans. In contrast to basic food, snacks are consumed additionally to other meals and may thereby lead to non-homeostatic energy intake. Snack food is also frequently associated with hedonic hyperphagia, a food intake independent from hunger. Analysis of brain activity patterns by manganese-enhanced MRI has previously revealed that the intake of potato chips in ad libitum fed rats strongly activates the reward system of the rat brain, which may lead to hedonic hyperphagia. The purpose of the present study was to develop a two-choice preference test to identify molecular determinants of snack food triggering extra food intake in ad libitum fed rats. Different kinds of test food were presented three times a day for 10 min each time. To minimize the influence of organoleptic properties, each test food was applied in a homogenous mixture with standard chow. Food intake as well as food intake-related locomotor activity were analyzed to evaluate the effects induced by the test foods in the two-choice preference test. In summary, fat (F), carbohydrates (CH), and a mixture of fat and carbohydrates (FCH) led to a higher food intake compared to standard chow. Notably, potato chip test food (PC) was highly significantly preferred over standard chow (STD) and also over their single main macronutrients F and CH. Only FCH induced an intake comparable to PC. Despite its low energy density, fat-free potato chip test food (ffPC) was also significantly preferred over STD and CH, but not over F, FCH, and PC. Thus, it can be concluded that the combination of fat and carbohydrates is a major molecular determinant of potato chips triggering hedonic hyperphagia. The applied two-choice preference test will facilitate future studies on stimulating and suppressive effects of other food components on non-homeostatic food intake. © 2014 Hoch, Pischetsrieder and Hess.},
author = {Hoch, Tobias and Pischetsrieder, Monika and Heß, Andreas},
doi = {10.3389/fpsyg.2014.00250},
faupublication = {yes},
journal = {Frontiers in Psychology},
keywords = {Eating behavior; Food intake; Macronutrients; Preference test; Rat; Snack food},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.snackf},
pages = {Art. 250},
peerreviewed = {Yes},
title = {{Snack} food intake in ad libitum fed rats is triggered by the combination of fat and carbohydrates},
volume = {5},
year = {2014}
}
@article{faucris.123929564,
abstract = {Current teaching states that when sodium intake is increased from low to high levels, total-body sodium (TBNa) and water increase until daily sodium excretion again equals intake. When sodium intake is reduced, sodium excretion briefly exceeds intake until the excess TBNa and water are eliminated, at which point sodium excretion again equals intake. However, careful balance studies oftentimes conflict with this view and long-term studies suggest that TBNa fluctuates independent of intake or body weight. We recently performed the opposite experiment in that we fixed sodium intake for several weeks at three levels of sodium intake and collected all urine made. We found weekly (circaseptan) patterns in sodium excretion that were inversely related to aldosterone and directly to cortisol. TBNa was not dependent on sodium intake but instead exhibited far longer (>= monthly) infradian rhythms independent of extracellular water, body weight, or blood pressure. The findings are consistent with our ideas on tissue sodium storage and its regulation that we developed on the basis of animal research. We are implementing (23)Na-magnetic resonance imaging (MRI) to pursue open questions on sodium balance in patients. Our findings could be relevant to therapeutic strategies for hypertension and target-organ damage.},
author = {Titze, Jens and Dahlmann, Anke and Lerchl, Kathrin and Kopp, Christoph and Rakova, Natalia and Schröder, Agnes and Luft, Friedrich C.},
doi = {10.1038/ki.2013.367},
faupublication = {yes},
journal = {Kidney International},
note = {EVALuna2:3656},
pages = {759-67},
peerreviewed = {Yes},
title = {{Spooky} sodium balance},
volume = {85},
year = {2014}
}
@article{faucris.260273135,
abstract = {The antimicrobial peptide Leg1 (RIKTVTSFDLPALRFLKL) from chickpea legumin is active against spoilage bacteria, yeast, and mold. The present study tested its effectiveness under food storage conditions and examined options to obtain a food-grade agent. The minimum inhibitory concentration (MIC) of Leg1 against E. coli (62.5 µM) proved stable over seven days at 20◦ C or 4◦ C. It was not influenced by reduced pH (5.0 vs. 6.8), which is relevant in food such as meat. An incubation temperature of 20◦ C vs. 37◦ C reduced the MIC to 15.6/7.8 µM against E. coli/B. subtilis. With a minimum bactericidal concentration in meat of 125/15.6 µM against E. coli/B. subtilis, Leg1 is equivalently effective as nisin and 5000–82,000 times more active than sodium benzoate, potassium sorbate, or sodium nitrite. Replacing the counter-ion trifluoroacetate derived from peptide synthesis by the more natural alternatives acetate or chloride did not impair the activity of Leg1. As an alternative to chemical synthesis, an optimized protocol for chymotryptic hydrolysis was developed, increasing the yield from chickpea legumin by a factor of 30 compared to the standard procedure. The present results indicate that food-grade Leg1 could possibly be applicable for food preservation.},
author = {Heymich, Marie-Louise and Srirangan, Showmika and Pischetsrieder, Monika},
doi = {10.3390/foods10061192},
faupublication = {yes},
journal = {Foods},
keywords = {Antimicrobial peptides; Chickpea; Chymotryptic hydrolysis; Counter-ions; Digestion optimization; Leg1; Meat},
note = {CRIS-Team Scopus Importer:2021-06-18},
peerreviewed = {Yes},
title = {{Stability} and activity of the antimicrobial peptide leg1 in solution and on meat and its optimized generation from chickpea storage protein},
volume = {10},
year = {2021}
}
@article{faucris.113837284,
abstract = {In peritoneal dialysis (PD), glucose degradation products (GDPs), which are formed during heat sterilization of dialysis fluids, lead to structural and functional changes in the peritoneal membrane, which eventually result in the loss of its ultrafiltration capacity. To determine the molecular mechanisms behind these processes, the present study tested the influence of the six major α-dicarbonyl GDPs in PD fluids, namely, glyoxal, methylglyoxal, 3-deoxyglucosone (3-DG), 3-deoxygalactosone (3-DGal), 3,4-dideoxyglucosone-3-ene (3,4-DGE), and glucosone with respect to their potential to impair the enzymatic activity of RNase A as well as their effects on cell viability. For comprehensive risk assessment, the α-dicarbonyl GDPs were applied separately and in concentrations as present in conventional PD fluids. Thus, it was shown that after 5 days, glucosone impaired RNase A activity most distinctly (58% remaining activity, p < 0.001 compared to that of the control), followed by 3,4-DGE (62%, p < 0.001), 3-DGal (66%, p < 0.001), and 3-DG (76%, p < 0.01). Methylglyoxal and glyoxal caused weaker inactivation with significant effects only after 10 days of incubation (79%, 81%, p < 0.001). Profiling of the advanced glycation end products formed during the incubation of RNase A with methylglyoxal revealed predominant formation of the arginine modifications imidazolinone, CEA/dihydroxyimidazoline, and tetrahydropyrimidine at Arg10, Arg33, Arg39, and Arg85. Particularly, modification at Arg39 may severely affect the active site of the enzyme. Additionally, structure- and concentration-specific assessment of the cytotoxicity of the α-dicarbonyl GDPs was performed. Although present at very low concentration, the cytotoxic effect of PD fluids after 2 days of incubation was exclusively caused by 3,4-DGE (14% cell viability, p < 0.001). After 4 days of incubation, 3-DGal (13% cell viability, p < 0.001), 3-DG (24%, p < 0.001), and, to a lower extent, glyoxal and methylglyoxal (both 57%, p < 0.01) also reduced cell viability significantly. In conclusion, 3,4-DGE, 3-DGal, and glucosone appear to be the most relevant parameters for the biocompatibility of PD fluids. © 2014 American Chemical Society.},
author = {Distler, Leonie and Georgieva, Angelina and Kenkell, Isabell and Huppert, Jochen and Pischetsrieder, Monika},
doi = {10.1021/tx500153n},
faupublication = {yes},
journal = {Chemical Research in Toxicology},
note = {UnivIS-Import:2015-03-09:Pub.2014.nat.dchph.llmch.struct},
pages = {1421-1430},
peerreviewed = {Yes},
title = {{Structure}- and concentration-specific assessment of the physiological reactivity of alpha-dicarbonyl glucose degradation products in peritoneal dialysis fluids},
url = {http://pubs.acs.org/doi/full/10.1021/tx500153n},
volume = {27},
year = {2014}
}
@article{faucris.111871804,
abstract = {Elucidation of the physiological role of the D3 receptor and its distribution in the brain using positron emission tomography (PET) is hampered by the lack of bioavailable subtype selective tracer ligands. To develop appropriate D3 radioligands, we designed an integrative procedure involving the elucidation of structural features determining D3 selectivity over both congeners D2 and D4 by comparative molecular analysis. Thus, we have successfully generated CoMFA and CoMSIA models based on the affinitiy differences of a series of 79 ligands representing a broad range of selectivities. These models yielded highly significant cross-validations (q2
cv(D3/D2) = 0.86; q2
cv(D3/D4) = 0.92) and excellent predictions of a 16-ligand test set (r2
pred = 0.79-0.93). Exploiting this information, synthesis and receptor binding studies directed us to the fluorinated lead compounds 78 and 79, featuring subnanomolar D3 affinities and considerable selectivities over D2 and D4 and, subsequently, to the subtype selective PET tracers [ 18F]78 and [18F]79. © 2007 American Chemical Society.},
author = {Utz, Wolfgang and Prante, Olaf and Hübner, Harald and Kuwert, Torsten and Gmeiner, Peter and et al.},
author_hint = {Salama Ismail, Hocke Carsten, Utz Wolfgang, Prante Olaf, Böckler Frank, Hübner Harald, Kuwert Torsten, Gmeiner Peter},
doi = {10.1021/jm0611152},
faupublication = {yes},
journal = {Journal of Medicinal Chemistry},
note = {UnivIS-Import:2015-04-14:Pub.2007.nat.dchph.lphch.struct},
pages = {489-500},
peerreviewed = {Yes},
support_note = {Author relations incomplete. You may find additional data in field 'author{\_}hint'},
title = {{Structure}-{Selectivity} {Investigations} of {D2}-like {Receptor} {Ligands} by {CoMFA} and {CoMSIA} {Guiding} the {Discovery} of {D3} {Selective} {PET} {Radioligands}},
volume = {50},
year = {2007}
}
@article{faucris.119564544,
author = {Kozon, Dominika and Zheng, Kai and Boccardi, Elena and Liu, Yufang and Liverani, Liliana and Boccaccini, Aldo R.},
doi = {10.3390/ma9040225},
faupublication = {yes},
journal = {Materials},
keywords = {Antibacterial activity; Bioactive glass nanoparticle; Bioactivity; Silver; Surface modification},
peerreviewed = {Yes},
title = {{Synthesis} of monodispersed {Ag}-doped bioactive glass nanoparticles via surface modification},
volume = {9},
year = {2016}
}
@article{faucris.122947484,
abstract = {Monocytes are a part of the innate immune system. Their differentiation into macrophages changes their cellular proteome and secretome. Particularly secretome components such as cytokines are crucial for immune response and inflammation in many diseases. Differentiation of human lymphoma cell line U937 can be triggered by phorbol 12-myristate 13-acetate (PMA). Screening of the cytokine release in U937 upon PMA stimulation by cytometric bead array almost exclusively showed interleukin-8. Next, a label-free nanoLC-ESI-MS/MS-sSRM method for quantification of interleukin-8 in the cell secretome was established and applied to monitor the time kinetics of PMA treatment in different concentrations. Targeted secretome analysis was achieved by scheduled SRM-MS using one proteotypic peptide as precursor ion and four mass transitions. Label-free quantification was performed by external calibration using interleukin-8 standard. Validation results indicated that the method was suited for the quantification of interleukin-8 in the secretome. The maximal interleukin-8 release of 62.4 ng/mL was observed after incubating cells treated by 50 ng/mL PMA for 48 h. The method can now be used for quantification of interleukin-8 release from different cells under various conditions. Furthermore, it can be easily expanded to other secreted proteins detected by untargeted screening methods. This article is protected by copyright. All rights reserve},
author = {Emirbayer, Pelin Esma and Gerer, Kerstin and Hoyer, Stefanie and Pischetsrieder, Monika},
doi = {10.1002/pmic.201600455},
faupublication = {yes},
journal = {Proteomics},
peerreviewed = {Yes},
title = {{Targeted} label-free quantification of interleukin-8 in {PMA}-activated {U937} cell secretome by {nanoLC}-{ESI}-{MS}/{MS}-{sSRM}.},
year = {2017}
}
@article{faucris.121024024,
abstract = {Comprehensive physiological food assessment requires recording of activity profiles. To elucidate the nutritive regulation of antioxidant enzymes, a generally applicable targeted MS method was established for the expression analysis of catalase and then adapted to heme oxygenase-1. Before tryptic digestion, target proteins were prefractionated by off-gel IEF of stimulated and control cell lysate. Targeted proteome analysis was achieved by LC coupled with scheduled selected reaction monitoring MS using 2 proteotypic peptides per protein and 3-4 transitions per peptide. Relative quantification was performed by stable isotope labeling by amino acids in cell culture (SILAC). The assay showed good correlation with results by Western blot. Linearity, precision, and sensitivity were even improved (LC/SRM vs. Western blot: 3 vs. 1 orders of magnitude, RSD 3.7-13.7% vs. 18.4%, LOD 0.2 vs. 1.6μg/mL). The developed method indicated that coffee does not modulate catalase expression in macrophages (T7cat 103±22%, T17cat 103±16%, p>0.05 vs. control), but leads to a highly significant increase of heme oxygenase-1 expression (T15Ho-1 420±24%, T22Ho-1 364±37%, p<0.001 vs. control, p>0.05 T15Ho-1 vs. T22Ho-1). In regard to multiplex options of the method, targeted proteome analysis can be a valuable tool for the comprehensive analysis of cellular effects of food components. Biological significance: In the present study, targeted mass spectrometry was applied to determine the influence of food components on the expression of antioxidative enzymes. The results implicate that targeted proteomics may develop into a valuable tool in food science and nutrition to determine the physiological effects of nutrients. In contrast to conventional methods for expression analysis, targeted proteome analysis can be applied to monitor the effects of a food component on a broad range of cellular targets in parallel. Additionally, proteins or protein modifications can be addressed which elude immunochemical methods.},
author = {Zänglein, Nina and Tucher, Joanna and Pischetsrieder, Monika},
doi = {10.1016/j.jprot.2015.01.010},
faupublication = {yes},
journal = {Journal of Proteomics},
keywords = {Expression analysis; Food proteomics; Nutrition; Selected reaction monitoring; SILAC; Targeted mass spectrometry},
note = {UnivIS-Import:2015-03-09:Pub.2015.nat.dchph.llmch.target},
pages = {58-69},
peerreviewed = {Yes},
title = {{Targeted} mass spectrometry for the analysis of nutritive modulation of catalase and heme oxygenase-1 expression},
volume = {117},
year = {2015}
}
@article{faucris.239262128,
abstract = {Ketamine (KET) was originally developed as an anesthetic agent but has also attracted attention for further clinical applications such as medical treatment of depression or pain. The use of KET induces dissociation and emergence delirium. Due to these effects, KET has a high potential for abuse. In order to investigate metabolization of KET or to confirm misuse of KET, highly sensitive analytical methods that cover KET and its metabolites are necessary. A new analytical approach for simultaneous analysis of KET and its metabolites cis-6-hydroxynorketamine (HNK) and norketamine (NK) was established. The compounds were extracted from human blood serum by ultrafiltration and solid phase extraction with subsequent vacuum evaporation. The compounds were analyzed by non-enantioselective ultra-high performance micro-flow liquid chromatography (Waters ACQUITY UPLC® M-Class HSS T3 column, 0.1% formic acid and acetonitrile with 0.1% formic acid, 14 µL/min flow rate) coupled with tandem mass spectrometry in positive scheduled multiple reaction monitoring mode. Validation parameters such as linearity, precision, recovery, accuracy, stability, limit of detection (LOD), and limit of quantification (LOQ) were proven. LOD for KET and NK was 0.08 ng/mL and LOQ were 0.5 ng/mL and 0.6 ng/mL, respectively. For HNK, LOD was 0.1 ng/mL and LOQ 0.8 ng/mL. The method was then successfully applied to quantify KET, HNK, and NK in blood serum samples from subjects who received KET intravenously. A novel method for the simultaneous analysis of KET, NK, and HNK was established. This new method could now be used for clinical trials investigating KET and its metabolites HNK and NK or for forensic analysis in order to confirm KET abuse.},
author = {Kurzweil, Lisa and Danyeli, Lena and Şen, Zümrüt Duygu and Fejtová, Anna and Walter, Martin and Gensberger-Reigl, Sabrina},
doi = {10.1016/j.jchromb.2020.122214},
faupublication = {yes},
journal = {Journal of Chromatography B-Analytical Technologies in the Biomedical and Life Sciences},
keywords = {cis-6-Hydroxynorketamine; Human blood serum; Ketamine; MicroLC–ESI–sMRM; Norketamine; Targeted mass spectrometry},
note = {CRIS-Team Scopus Importer:2020-06-16},
peerreviewed = {Yes},
title = {{Targeted} mass spectrometry of ketamine and its metabolites cis-6-hydroxynorketamine and norketamine in human blood serum},
volume = {1152},
year = {2020}
}
@article{faucris.211173119,
abstract = {The Nrf2 signaling pathway is highly significant for redox homeostasis. Hence, nutrients and drugs activating Nrf2 can prevent oxidative stress-mediated medical conditions. After activation, Nrf2 accumulates in the cell nucleus; therefore, stimulation of Nrf2 by food components and drugs is usually monitored by measuring nuclear Nrf2 levels. The present study developed a targeted mass spectrometry method for the highly reliable quantification of nuclear Nrf2 levels. Three Nrf2-specific peptides were detected after enzymatic digestion of the nuclear fraction by the developed protocol for micro-liquid chromatography-tandem mass spectrometry in scheduled multiple reaction monitoring mode (microLC-MS/MS-sMRM). The method also identified nuclear Nrf2 unequivocally and specifically in the SDS-PAGE fraction of 100-150 kDa. Moreover, highly precise and linear relative quantification was achieved (mean relative standard deviation 8.3%; coefficient of determination 0.998). Incubation experiments in SH-SY5Y neuroblastoma cells revealed significantly up to 6-fold elevated nuclear Nrf2 levels after stimulation with 10 μM carnosol (rosemary), 10 μM sulforaphane (broccoli), or 20 μM cinnamaldehyde (cinnamon). Our results were in very good accordance with conventional Nrf2 western blotting and were highly correlated with the food components' effect on the expression levels of NAD(P)H dehydrogenase [quinone] 1 and thioredoxin reductase 1, two major Nrf2-regulated cytoprotective enzymes. The newly developed microLC-MS/MS-sMRM method shows broad applicability and can serve as a highly selective and reliable method to analyze Nrf2 activation. Graphical abstract ᅟ.},
author = {Östreicher, Christiane and Gensberger-Reigl, Sabrina and Pischetsrieder, Monika},
doi = {10.1007/s00216-018-1560-2},
faupublication = {yes},
journal = {Analytical and Bioanalytical Chemistry},
keywords = {Carnosol; NAD(P)H dehydrogenase [quinone]; Nrf2; Scheduled multiple reaction moniotring; Sulforaphane; Targeted mass spectrometry},
pages = {1273-1286},
peerreviewed = {Yes},
title = {{Targeted} mass spectrometry to monitor nuclear accumulation of endogenous {Nrf2} and its application to {SH}-{SY5Y} cells stimulated with food components.},
volume = {411},
year = {2019}
}
@article{faucris.123706044,
abstract = {The present study demonstrated that the major components of cinnamon and rosemary, respectively, i.e. cinnamaldehyde and carnosol, are potent alimentary candidates to increase the expression of cytoprotective enzymes in the human colon. Among the investigated enzymes, NAD(P)H dehydrogenase [quinone] 1 (NQO1) was most susceptible towards modulation by phytochemicals. NQ01 exerts its cytoprotective activity by detoxifying electrophilic and oxidative xenobiotics with quinone structure. (C) 2017 Elsevier B.V. All rights reserved.},
author = {Östreicher, Christiane and Bartenbacher, Sven and Pischetsrieder, Monika},
doi = {10.1016/j.jprot.2017.06.023},
faupublication = {yes},
journal = {Journal of Proteomics},
keywords = {Carnosol; cinnamaldehyde; cytoprotective enzymes; primary human colon cells; scheduled selected reaction monitoring; targeted proteome analysis},
pages = {27-38},
peerreviewed = {Yes},
title = {{Targeted} proteome analysis with isotope-coded protein labels for monitoring the influence of dietary phytochemicals on the expression of cytoprotective proteins in primary human colon cells},
volume = {166},
year = {2017}
}
@article{faucris.308924632,
abstract = {Alcohol consumption is a widespread behaviour that may eventually result in the development of alcohol use disorder (AUD). Alcohol, however, is rarely consumed in pure form but in fruit- or corn-derived preparations, like beer. These preparations add other compounds to the consumption, which may critically modify alcohol intake and AUD risk. We investigated the effects of hordenine, a barley-derived beer compound on alcohol use-related behaviours. We found that the dopamine D2 receptor agonist hordenine (50 mg/kg) limited ongoing alcohol consumption and prophylactically diminished relapse drinking after withdrawal in mice. Although not having reinforcing effects on its own, hordenine blocked the establishment of alcohol-induced conditioned place preference (CPP). However, it independently enhanced alcohol CPP retrieval. Hordenine had a dose-dependent inhibitory effect on locomotor activity. Chronic hordenine exposure enhanced monoamine tissue levels in many brain regions. Further characterization revealed monoaminergic binding sites of hordenine and found a strong binding on the serotonin and dopamine transporters, and dopamine D3, and adrenergic α1A and α2A receptor activation but no effects on GABAA receptor or glycinergic signalling. These findings suggest that natural ingredients of beer, like hordenine, may work as an inhibitory and use-regulating factor by their modulation of monoaminergic signalling in the brain.},
author = {Li, Yan and Vogel, Christina and Kalinichenko, Liubov and Hübner, Harald and Weikert, Dorothée and Schaefer, Natascha and Gmeiner, Peter and Villmann, Carmen and Pischetsrieder, Monika and Müller, Christian P.},
doi = {10.1111/adb.13305},
faupublication = {yes},
journal = {Addiction Biology},
keywords = {addiction; alcohol; conditioned preference; drinking; hordenine},
note = {CRIS-Team Scopus Importer:2023-08-11},
peerreviewed = {Yes},
title = {{The} beer component hordenine inhibits alcohol addiction-associated behaviours in mice},
volume = {28},
year = {2023}
}
@article{faucris.240278755,
abstract = {Archaeology has yet to capitalise on the opportunities offered by bioarchaeological approaches to examine the impact of the 11th-century AD Norman Conquest of England. This study utilises an integrated multiproxy analytical approach to identify and explain changes and continuities in diet and foodways between the 10th and 13th centuries in the city of Oxford, UK. The integration of organic residue analysis of ceramics, carbon (δ13C) and nitrogen (δ15N) isotope analysis of human and animal bones, incremental analysis of δ13C and δ15N from human tooth dentine and palaeopathological analysis of human skeletal remains has revealed a broad pattern of increasing intensification and marketisation across various areas of economic practice, with a much lesser and more short-term impact of the Conquest on everyday lifestyles than is suggested by documentary sources. Nonetheless, isotope data indicate short-term periods of instability, particularly food insecurity, did impact individuals. Evidence of preferences for certain foodstuffs and cooking techniques documented among the elite classes were also observed among lower-status townspeople, suggesting that Anglo-Norman fashions could be adopted across the social spectrum. This study demonstrates the potential for future archaeological research to generate more nuanced understanding of the cultural impact of the Norman Conquest of England, while showcasing a method which can be used to elucidate the undocumented, everyday implications of other large-scale political events on non-elites.
ε-(carboxymethyl) lysine (CML), and imidazolone. Clinical end points were residual renal function (RRF), adequacy of dialysis, ultrafiltration, and peritoneal membrane function. Eighty-six patients were randomized to either group I starting with SPDF for 12 weeks (Phase I), then switching to "balance" for 12 weeks (Phase II), or group II, which was treated vice versa. Seventy-one patients completed the study with data suitable for entry into the per protocol analysis. Effluent and serum samples, together with peritoneal function tests and adequacy measurements, were undertaken at study centers on three occasions during the study: after the four-week run-in period, after Phase I, and again after Phase II. Results. In patients treated with balance there were significantly higher effluent levels of CA125 and PICP in both arms of the study. Conversely, levels of HA were lower in patients exposed to balance, while there was no change in the levels of either VEGF or TNFα. Serum CML and imidazolone levels fell significantly in balance-treated patients. Renal urea and creatinine clearances were higher in both treatment arms after patients were exposed to balance. Urine volume was higher in patients exposed to balance. In contrast, peritoneal ultrafiltration was higher in patients on SPDF. When anuric patients were analyzed as a subgroup, there was no significant difference in peritoneal transport characteristics or in ultrafiltration on either fluid. There were no changes in peritonitis incidence on either solution. Conclusion. This study indicates that the use of balance, a neutral pH, low GDP fluid, is accompanied by a significant improvement in effluent markers of peritoneal membrane integrity and significantly decreased circulating AGE levels. Clinical parameters suggest an improvement in residual renal function on balance, with an accompanying decrease in peritoneal ultrafiltration. It would appear that balance solution results in an improvement in local peritoneal homeostasis, as well as having a positive impact on systemic parameters, including circulating AGE and residual renal function.},
author = {Williams, John D. and Topley, Nicholas and Craig, Kathrine J. and Mackenzie, Ruth K. and Pischetsrieder, Monika and Lage, Cristina and Passlick-Deetjen, Jutta},
doi = {10.1111/j.1523-1755.2004.00747.x},
faupublication = {yes},
journal = {Kidney International},
keywords = {Biocompatibility; Cancer antigen 125; Glucose degradation products; pH neutral; Residual renal function; Ultrafiltration},
note = {UnivIS-Import:2015-03-09:Pub.2004.nat.dchph.llmch.theeur},
pages = {408-418},
peerreviewed = {Yes},
title = {{The} {Euro}-{Balance} {Trial}: {The} effect of a new biocompatible peritoneal dialysis fluid (balance) on the peritoneal membrane},
volume = {66},
year = {2004}
}
@article{faucris.117581024,
abstract = {Sideritis plants and their extracts have been used in traditional medicine as sedatives, anxiolytics and anticonvulsant agents. Pinenes are the most prevalent of the volatile aroma components in Siderites extracts and the pinene metabolites myrtenol and verbenol have been identified as the most potent positive allosteric modulators of synaptic GABAA receptors composed of α1β2 and α1β2γ2 subunits. In view of their therapeutic spectrum, we wondered whether these two terpenoids would also augment tonic GABA currents mediated by extrasynaptic GABAA receptors containing the δ subunit. When we expressed α4β2δ receptors in HEK293 cells, we found that co-application of myrtenol or verbenol enhanced whole-cell current responses to GABA by up to 100%. Consistent with their effects on heterologous α1β2γ2 receptors, we found that myrtenol and verbenol, when co-applied with GABA via local perfusion, increased the amplitude and area of miniature inhibitory postsynaptic potentials (mIPSCs) recorded in whole-cell voltage-clamp recordings from granule cells in the dentate gyrus of mouse hippocampal brain slices. In addition, co-application of terpenoids with GABA was also able to enhance tonic GABA current, measured from the change in baseline current and current noise, compared to GABA perfusion alone. Our results suggest that myrtenol and verbenol act as positive allosteric modulators at synaptic and extrasynaptic GABAA receptors, thereby augmenting phasic and tonic GABAergic inhibition. Thus, our study reveals an important pharmacological and therapeutic target of bicyclic monoterpenoids.},
author = {van Brederode, Johannes and Milanos, Sinem and Kessler, Artur and Pischetsrieder, Monika and Villmann, Carmen and Alzheimer, Christian},
doi = {10.1016/j.neulet.2016.06.027},
faupublication = {yes},
journal = {Neuroscience Letters},
pages = {91-97},
peerreviewed = {Yes},
title = {{The} terpenoids {Myrtenol} and {Verbenol} act on δ subunit-containing {GABAA} receptors and enhance tonic inhibition in dentate gyrus granule cells.},
volume = {628},
year = {2016}
}
@article{faucris.230225453,
abstract = {Isolation of lipophilic compounds by
countercurrent chromatography (CCC) is a challenge because biphasic
solvent systems in which these compounds distribute evenly are difficult
to obtain. In this article we present novel applications of lipid
compound isolation from natural sources. Conjugated linolenic acids
(CLnAs, log KOW ∼7) were isolated from pomegranate oil using a solvent system consisting of n-heptane/methanol/water
100:91:9 (v/v/v). The CLnA fraction was free of other fatty acids but
consisted of different isomers which were not resolved from each other.
In the less polar range (log KOW ∼12), three tocotrienols
(α-, γ- and δ-tocotrienol) were isolated from a vitamin E capsule
produced from palm oil by using the solvent system n-hexane/acetonitrile/benzotrifluoride (BTF) at a ratio of 10:6.5:3.5 (v/v/v). Between 36 and 65 mg
of each of the three tocotrienols were obtained in one injection with
purities >97%. Advantages and disadvantages of the “BTF system” are
discussed by comparing the phase composition with the simple n-hexane/acetonitrile system and by the fractionation of phytosterols (log KOW ∼9.5) from rapeseed oil.
},
author = {Vetter, Walter and Hammann, Simon and Müller, Marco and Englert, Michael and Huang, Yining},
doi = {10.1016/j.chroma.2017.04.035},
faupublication = {no},
journal = {Journal of Chromatography A},
keywords = {BTF system; Conugated linolenic acids; Tocotrienols; Countercurrent chromatography; Lipid compounds},
pages = {51-60},
peerreviewed = {Yes},
title = {{The} use of countercurrent chromatography in the separation of nonpolar lipid compounds},
url = {https://www.sciencedirect.com/science/article/pii/S0021967317305897},
volume = {1501},
year = {2017}
}
@article{faucris.110980804,
abstract = {Potentiation of γ-amino butyric acid (GABA)-induced GABAA receptor (GABAAR) activation is a common pathway to achieve sedative, sleep-enhancing, anxiolytic, and antidepressant effects. Presently, a three-component test system was established for the identification of novel GABAAR modulating food plants. In the first step, potentiation of GABA-induced response of the GABAAR was analysed by two-electrode voltage clamp (TEVC) for activity on human α1β2-GABAAR expressed in Xenopus laevis oocytes. Positively tested food plants were then subjected to quantification of GABA content by high-performance liquid chromatography
with fluorescence detection (HPLC–FLD) to exclude test foods, which evoke a TEVC-response by endogenous GABA. In the third step, specificity of GABAA-modulating activity was assessed by TEVC analysis of Xenopus laevis oocytes expressing the homologous glycine receptor
(GlyR). The three-component test was then applied to screen 10 aqueous extracts of food plants for their GABAAR activity. Thus, hop cones (Humulus lupulus) and Sideritis sipylea were
identified as the most potent specific GABAAR modulators eliciting significant potentiation of the current by 182 ± 27 and 172 ± 19 %, respectively, at the lowest concentration of
0.5 μg/mL. The extracts can now be further evaluated by in vivo studies and by structural evaluation of the active components.},
author = {Sahin, Sümeyye and Eulenburg, Volker and Kreis, Wolfgang and Villmann, Carmen and Pischetsrieder, Monika},
doi = {10.1007/s11130-016-0566-1},
faupublication = {yes},
journal = {Plant Foods For Human Nutrition},
keywords = {GABAA receptor; GABA; Glycine receptor; Sideritis; Lemon balm leaves; Hop cones},
note = {EVALuna2:4740},
pages = {355-360},
peerreviewed = {Yes},
title = {{Three}-step test system for the identification of novel {GABAa} receptor modulating food plants},
url = {http://rdcu.be/nkD9},
volume = {71},
year = {2016}
}
@article{faucris.230232381,
abstract = {Palm oil is one of the richest
sources of tocotrienols and may contain other non-tocopherol vitamin E
congeners. The vitamin E profiles of fully ripened fruit mesocarp of
three Elaeis guineensis, two Elaeis oleifera, and one
hybrid O × G palm fruit genotypes from Costa Rica were analyzed by
high-performance liquid chromatography with fluorescence detection and
gas chromatography–mass spectrometry after mechanical extraction by a
screw press and chemical extraction with hexane. γ-Tocotrienol,
α-tocotrienol, and α-tocopherol were the most abundant tocochromanols,
while other tocopherols (β-tocopherol, γ-tocopherol, and δ-tocopherol)
and α-tocomonoenol were detected at minor concentrations. Significant
differences in vitamin E profiles between genotypes were observed, and
the variety E. oleifera Quepos (CB9204) had by far the highest
content of total tocotrienols (890 μg/g of oil) and total vitamin E (892
μg/g of oil). Chemical extraction with hexane afforded up to 2.5-fold
higher vitamin E yields than screw press extraction. α-Tocomonoenol
co-eluted with γ-tocopherol in reversed-phase high-performance liquid
chromatography analyses and is a possible source of error in the
quantification of γ-tocopherol in food},
author = {Irias-Mata, Andrea and Stuetz, Wolfgang and Sus, Nadine and Hammann, Simon and Gralla, Katrin and Cordero-Solano, Aracelly and Vetter, Walter and Frank, Jan},
doi = {10.1021/acs.jafc.7b02230},
faupublication = {no},
journal = {Journal of Agricultural and Food Chemistry},
keywords = {Vitamin E; Elaeis oleifera; hybrid O × G; chromatography; Elaeis guineensis; palm oil extraction byproducts; pumpkin seed oil; oil extraction; palm fruit oil},
pages = {7476-7482},
peerreviewed = {Yes},
title = {{Tocopherols}, {Tocomonoenols}, and {Tocotrienols} in {Oils} of {Costa} {Rican} {Palm} {Fruits}: {A} {Comparison} between {Six} {Varieties} and {Chemical} versus {Mechanical} {Extraction}},
url = {https://pubs.acs.org/doi/abs/10.1021/acs.jafc.7b02230},
volume = {65},
year = {2017}
}
@article{faucris.230225800,
abstract = {The uptake of cereal agriculture in the Neolithic is one of the most important processes in later human prehistory.
However, in many parts of Europe, early evidence from pollen or
macrofossils is scarce or inconclusive, and there are considerable
ambiguities about timing, intensity and the mode of transition to
agriculture in these regions.
An alternative
approach is organic residue analysis, a technique that targets lipids
preserved in the walls of unglazed ceramic pots used for storage and
processing of foodstuffs. By analysing the molecular and isotopic
composition of absorbed lipid residues, many different food items and
processing techniques can be detected and distinguished. However, this
approach is by-and-large limited to animal-based food sources, and
despite their importance, many plant-based food items including cereals
are currently not accessible with this approach.
For
a better understanding of the behaviour of cereal lipids, cooking
experiments were conducted and the uptake of cereal-specific compounds
such as alkylresorcinols and plant sterols into the ceramic matrix was
investigated using a new sensitive method based on GC-Q-ToF-MS.
Furthermore, changes in the lipid composition through post-burial
degradation was assessed by incubation of potsherds dosed with cereal
lipids at 35 °C in compost. The cooking experiments showed that only
small quantities of cereal lipids are liberated, but additional lipid
sources (meat) can increase the transfer of cereal biomarkers into the
ceramic matrix. Anoxic degradation conditions allowed for twentyfold
higher levels of alkylresorcinols and twofold higher levels of plant
sterols after 20 weeks compared to oxic conditions. Therefore, samples
from anoxic burial environments should be targeted and high sensitivity
methods are a necessity to detect the trace amounts of cereal-specific
biomarkers. To test the applicability of these biomarkers for
archaeological pottery, organic residues from ten coarse ware vessels
from an anoxic burial context at Vindolanda were analysed. Plant sterols
and stanols were detected in three sherds, and two of the sherds also
contained traces of alkylresorcinols.
},
author = {Hammann, Simon and Cramp, Lucy},
doi = {10.1016/j.jas.2018.02.017},
faupublication = {no},
journal = {Journal of Archaeological Science},
keywords = {Cereal; Alkylresorcinol; Lipid; Degradation; Sterol; Pottery; Vindolanda},
pages = {74-81},
peerreviewed = {Yes},
title = {{Towards} the detection of dietary cereal processing through absorbed lipid biomarkers in archaeological pottery},
url = {https://www.sciencedirect.com/science/article/pii/S0305440318300530},
volume = {93},
year = {2018}
}
@article{faucris.257515811,
abstract = {
The transfer of certain substances from the maternal diet or medication into breast milk has been known for many years. There is currently also an increasing interest in odorants in human milk and their potential influence on the breastfed child. Nevertheless, metabolic products originating from bioconversion of odorants within the maternal organism have hitherto not been considered. Breastfed children may take in xenobiotic compounds that are transferred unmodified into human milk, but also their metabolic derivatives. Metabolic activation is a crucial point for evaluation of both positive and negative biological effects, thus it is important to understand the basic principles of metabolism in human milk. The present study investigated metabolite profiles of the odorant 1,8-cineole (eucalyptol) in human milk after lactating mothers ingested a non-prescription pharmaceutical (Soledum®) containing this substance. Ten different metabolites were identified, five of which have been previously described in humans and other mammals (α2-hydroxy-1,8-cineole, β2-hydroxy-1,8-cineole, α3-hydroxy-1,8-cineole, 7-hydroxy-1,8-cineole, 9-hydroxy-1,8-cineole). Three of the metabolites have hitherto only been found in microorganisms and insects (2-oxo-1,8-cineole, 3-oxo-1,8-cineole, 2,3-dehydro-1,8-cineole) and the derivatives α2,3-epoxy-1,8-cineole and 4-hydroxy-1,8-cineole have never before been identified as metabolites of 1,8-cineole. Metabolism profiles showed large inter- and intra-individual differences and were strongly related to sampling time. Identification and relative quantification of the metabolites were accomplished by gas chromatography–mass spectrometry (GC–MS) after preparation of the human milk extracts by solvent assisted flavour evaporation (SAFE). Synthesised reference substances were used to confirm the chemical identity of the detected substances.
®) containing this substance. Ten different metabolites were identified, five of which have been previously described in humans and other mammals (α2-hydroxy-1,8-cineole, β2-hydroxy-1,8-cineole, α3-hydroxy-1,8-cineole, 7-hydroxy-1,8-cineole, 9-hydroxy-1,8-cineole). Three of the metabolites have hitherto only been found in microorganisms and insects (2-oxo-1,8-cineole, 3-oxo-1,8-cineole, 2,3-dehydro-1,8-cineole) and the derivatives α2,3-epoxy-1,8-cineole and 4-hydroxy-1,8-cineole have never before been identified as metabolites of 1,8-cineole. Metabolism profiles showed large inter- and intra-individual differences and were strongly related to sampling time. Identification and relative quantification of the metabolites were accomplished by gas chromatography-mass spectrometry (GC-MS) after preparation of the human milk extracts by solvent assisted flavour evaporation (SAFE). Synthesised reference substances were used to confirm the chemical identity of the detected substances. © 2012 Springer Science+Business Media New York.},
author = {Kirsch, Frauke and Horst, Kathie and Röhrig, Waldemar and Rychlik, Michael and Büttner, Andrea},
doi = {10.1007/s11306-012-0466-9},
faupublication = {yes},
journal = {Metabolomics},
keywords = {1,8-Cineole; Cytochrome P450; Gas-chromatography mass-spectrometry; Human milk; Hydroxy-cineole; Metabolites},
note = {UnivIS-Import:2015-03-09:Pub.2013.nat.dchph.llmch.tracin},
pages = {483-496},
peerreviewed = {Yes},
title = {{Tracing} metabolite profiles in human milk: {Studies} on the odorant 1,8-cineole transferred into breast milk after oral intake},
volume = {9},
year = {2013}
}
@article{faucris.111463484,
abstract = {Advanced glycation end-products are uremic toxins that accumulate in the serum and tissues of patients with chronic renal failure. Here, we established two enzyme-linked immunosorbent assays (ELISAs) for Nε-carboxymethyllysine and imidazolone to analyze advanced glycation end-products in human serum. Both ELISAs detected advanced glycation endproducts bound to human serum albumin in a dosedependent way. Whereas the formation of imidazolone was independent of the presence of oxygen, concentrations of Nε-carboxymethyllysine epitopes increased 20-fold under oxidative conditions. The Nε-carboxymethyllysine ELISA showed a similar response to free, peptide-bound and protein-bound Nε-carboxymethyllysine, whereas the imidazolone antibody showed slightly higher affinity toward peptide-bound compared to protein-bound imidazolone. In human serum, linear dilution ranges from 1:10 to 1:40 (Nε-carboxymethyllysine ELISA) and from 1:2 to 1:8 (imidazolone ELISA) were found. The recovery of Nε-carboxymethyllysine from serum was 101±10% and 94±12%, respectively, and 93±15% and 97±12% for imidazolone. The coefficients of variation for intraassay variability were 0.26-2.7% (Nε-carboxymethyllysine) and 0.1-2.4% (imidazolone), and 8.3-13.4% (Nε-carboxymethyllysine) and 7.8-12.5% (imidazolone) for inter-assay variability. In serum samples from hemodialysis patients (n = 20) and controls (n = 20), an approximately two-fold increase was detected in the patient group (p<0.001). The combination of the Nε-carboxymethyllysine and imidazolone ELISAs is a valuable tool to measure serum concentrations of advanced glycation end-products for clinical studies. © 2005 by Walter de Gruyter.},
author = {Zhang, Xiaohong and Frischmann, Matthias and Kientsch-Engel, Rose and Steinmann, Katharina and Stopper, Helga and Niwa, Toshimitsu and Pischetsrieder, Monika},
doi = {10.1515/CCLM.2005.089},
faupublication = {yes},
journal = {Clinical Chemistry and Laboratory Medicine},
keywords = {Advanced glycation end-products; Enzyme-linked immunosorbent assay (ELISA); Imidazolone; Nε-carboxymethyllysine(CML); Serum},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.llmch.twoimm},
pages = {503-511},
peerreviewed = {Yes},
title = {{Two} immunochemical assays to measure advanced glycation end-products in serum from dialysis patients},
volume = {43},
year = {2005}
}
@article{faucris.111766204,
abstract = {Advanced glycation end products (AGEs), e.g., carboxymethyllysine (CML) or imidazolone are involved in several age-related disorders. Concerning their accumulation, the importance of hepatic and renal function is controversially discussed. To test whether impairment of hepatic or renal function will affect their accumulation, both AGEs have been measured in various populations, such as 52 patients with liver disease [viral hepatitis C without (n = 19) and with (n = 10) fatty liver; nonalcoholic fatty liver (n = 13), nonalcoholic steatohepatitis (n = 10)]. Serum concentrations of both AGEs have been compared to those in 20 healthy controls and 24 patients with moderate renal impairment (creatinine clearance 23-55 ml/min). Concerning CML (95% C.I. 803-1200 ng/ml), no differences between the various groups could be observed. Likewise, serum levels of imidazolone (95% C.I. 1.3-5.6 units) were similar in all populations. In conclusion, moderate impairment in hepatic or in renal function did not affect serum levels of CML and imidazolone. Apparently, any increase observed in severe cirrhosis or renal failure seems to be rather a consequence than a cause of both disorders. © 2007 Springer-Verlag.},
author = {Butscheid, Moritz and Schäfer, Christian and Brenner, Stefanie and Alscher, Dominik and Mürdter, Thomas and Niwa, Toshimitsu and Frischmann, Matthias and Pischetsrieder, Monika and Klotz, Ulrich},
doi = {10.1007/s00210-007-0171-9},
faupublication = {yes},
journal = {Naunyn-Schmiedeberg's Archives of Pharmacology},
keywords = {Accumulation; Carboxymethyllysine; Elimination; Imidazalone; Liver disease; Renal impairment},
note = {UnivIS-Import:2015-03-09:Pub.2007.nat.dchph.llmch.unchan},
pages = {401-406},
peerreviewed = {Yes},
title = {{Unchanged} serum levels of advanced glycation endproducts in patients with liver disease},
volume = {375},
year = {2007}
}
@article{faucris.257180520,
author = {Lopez Pinar, Angela and Ghadiriasli, Rahil and Darriet, Philippe and Büttner, Andrea},
doi = {10.1016/j.foodchem.2016.10.021},
faupublication = {yes},
journal = {Food Chemistry},
pages = {498–504},
peerreviewed = {Yes},
title = {{Unexpected} impact of 2-methylisoborneol as off-odour substance in aged wines.},
year = {2017}
}
@article{faucris.257174117,
abstract = {Horseradish (Armoracia rusticana) is a plant well known for its
roots’ spicy aroma. The present study investigates the main aroma
constituents of horseradish roots in general by analysing the aroma
profiles of six different horseradish varieties, with one variety grown
in two different soils. Odorants were characterised by means of gas
chromatography-olfactometry and identified via their mass spectra,
retention indices on two columns with different polarity, and their
characteristic odour. A series of new aroma compounds from different
substance groups were identified that have hitherto not been described
in horseradish. Moreover, several of these constituents were
successfully shown to exhibit high odour potency, alongside a high
potential to influence the overall aroma of horseradish roots, like (3S,3aS,7aR)-wine lactone and 3-isopropyl-2-methoxypyrazin},
author = {Kröner, Eva-Maria and Büttner, Andrea},
doi = {10.1016/j.foodchem.2017.04.042},
faupublication = {yes},
journal = {Food Chemistry},
keywords = {Preparative gas chromatography; Allyl isothiocyanate; 2-Phenylethyl isothiocyanate; 1-Cyano-2,3-epithiopropane; Wine lactone; 3-Isopropyl-2-methoxypyrazine; 3-sec-Butyl-2-methoxypyrazine; Skatole},
pages = {455-465},
peerreviewed = {Yes},
title = {{Unravelling} important odorants in horseradish ({Armoracia} rusticana).},
volume = {232},
year = {2017}
}
@article{faucris.257174394,
author = {Kröner, Eva-Maria and Büttner, Andrea},
doi = {10.1016/j.foodchem.2017.04.042},
faupublication = {yes},
journal = {Food Chemistry},
pages = {455-465},
peerreviewed = {Yes},
title = {{Unravelling} important odorants in horseradish ({Armoracia} rusticana).},
year = {2017}
}
@article{faucris.234386253,
abstract = {Nonenzymatic post-translational protein modifications (nePTMs) affect the nutritional, physiological, and technological properties of proteins in food and in vivo. In contrast to the usual targeted analyses, the present study determined nePTMs in processed milk in a truly untargeted proteomic approach. Thus, it was possible to determine to which extent known nePTM structures explain protein modifications in processed milk and to detect and identify novel products. The method combined ultrahigh-performance liquid chromatography coupled to electrospray ionization tandem mass spectrometry with bioinformatic data analysis by the software XCMS. The nePTMs detected by untargeted profiling of a β-lactoglobulin-lactose model were incorporated in a sensitive scheduled multiple reaction monitoring method to analyze these modifications in milk samples and to monitor their reaction kinetics during thermal treatment. Additionally, we identified the structures of unknown modifications. Lactosylation, carboxymethylation, formylation of lysine and N-terminus, glycation of arginine, oxidation of methionine, tryptophan, and cysteine, oxidative deamination of N-terminus, and deamidation of asparagine and glutamine were the most important reactions of β-lactoglobulin during milk processing. The isomerization of aspartic acid was observed for the first time in milk products, and N-terminal 4-imidazolidinone was identified as a novel nePTM.},
author = {Meltretter, Jasmin and Wüst, Johannes and Dittrich, Daniel and Lach, Johannes and Ludwig, Jonas and Eichler, Jutta and Pischetsrieder, Monika},
doi = {10.1021/acs.jproteome.9b00630},
faupublication = {yes},
journal = {Journal of Proteome Research},
keywords = {mass spectrometry; processed milk; protein modifications; untargeted profiling; β-lactoglobulin},
note = {CRIS-Team Scopus Importer:2020-02-18},
pages = {805-818},
peerreviewed = {Yes},
title = {{Untargeted} {Proteomics}-{Based} {Profiling} for the {Identification} of {Novel} {Processing}-{Induced} {Protein} {Modifications} in {Milk}},
volume = {19},
year = {2020}
}
@article{faucris.111464584,
abstract = {A radiochemical method for the 18F-glycosylation of amino acid side chains was developed starting from peracetylated 2-deoxy-2-[18F]fluoroglucopyranoside (TA-[18F]FDG). O-(2-deoxy-2-[18F]fluoro-d-glucopyranosyl)-l-serine and the corresponding threonyl compound were obtained in a radiochemical yield of 25% and 12% (related to [18F]fluoride), respectively, after Zemple´n deprotection within a total reaction time of 90 min. The anomeric configuration of the corresponding 19Fsubstituted compounds revealed preferential a-stereoselectivity. The 18F-glycosylation method using TA-[18F]FDG is compatible with the short half-life of fluorine-18 and combines glycosylation and 18F-labelling of a target compound within a single reaction step. TA-[18F]FDG is a promising 18F-labelled prosthetic group and could be adapted to 18F-labelling of bioactive peptides to study their pharmacokinetics using positron emission tomography (PET).},
author = {Maschauer, Simone and Pischetsrieder, Monika and Kuwert, Torsten and Prante, Olaf},
doi = {10.1002/jlcr.963},
faupublication = {yes},
journal = {Journal of Labelled Compounds & Radiopharmaceuticals},
keywords = {18F-glycosylation; F-18; glycosidic linkage; positron-emission-tomography; PET},
note = {UnivIS-Import:2015-03-09:Pub.2005.nat.dchph.llmch.utilit},
pages = {701-719},
peerreviewed = {Yes},
title = {{Utility} of 1,3,4,6-tetra-{O}-acetyl-2-deoxy-2[{18F}]fluoro-glucopyranoside for no-carrier-added {18F}-glycosylation of amino acids},
volume = {48},
year = {2005}
}
@article{faucris.110174504,
author = {Röhrig, Waldemar and et al.},
author_hint = {Röhrig Waldemar, Hoch Tobias},
faupublication = {yes},
journal = {Lebensmittelchemie},
note = {UnivIS-Import:2017-12-18:Pub.2015.nat.dchph.llmch.vaccen},
pages = {37-38},
peerreviewed = {No},
support_note = {Author relations incomplete. You may find additional data in field 'author{\_}hint'},
title = {{Vaccensäure}-{Ethanolamid} ({VEA}) - {Ein} neues endogenes {Fettsäure}-{Ethanolamid} im {Endocannabinoid}-{System} von {Ratte} und {Mensch}},
volume = {69},
year = {2015}
}
@article{faucris.230232783,
abstract = {Erucic acid is a typical constituent of mustard or rape. Foodstuff with a
high content of erucic acid is considered undesirable for human
consumption because it has been linked to myocardial lipidosis and heart
lesions in laboratory rats. As a result, several countries have
restricted its presence in oils and fats. In this study, the erucic acid
content in several mustard oils and prepared mustard samples from
Germany and Australia was determined. Seven of nine mustard oil samples
exceeded the permitted maximum levels established for erucic acid
(range: 0.3–50.8%, limit: 5%). The erucic acid content in mustard
samples (n = 15) varied from 14% to 33% in the lipids. Two servings (i.e. 20 g)
of the mustards with the highest erucic acid content already surpassed
the tolerable daily intake established by Food Standards Australia New
Zealand. However, a careful selection of mustard cultivars could lower
the nutritional intake of erucic aci},
author = {Wendlinger, Christine and Hammann, Simon and Vetter, Walter},
doi = {10.1016/j.foodchem.2013.12.073},
faupublication = {no},
journal = {Food Chemistry},
keywords = {Erucic acid; Prepared mustard; Tolerable daily intake; Fatty acid; Mustard oil},
pages = {393-397},
peerreviewed = {Yes},
title = {{Various} concentrations of erucic acid in mustard oil and mustard},
url = {https://www.sciencedirect.com/science/article/pii/S0308814613019419},
volume = {153},
year = {2014}
}
@article{faucris.114022304,
abstract = {Scope: Milk provides a wide range of bioactive substances, such as antimicrobial peptides and
proteins. Our study aimed to identify novel antimicrobial peptides naturally present in milk.
Methods and results: The components of an endogenous bovine milk peptide database were
virtually screened for charge, amphipathy, and predicted secondary structure. Thus, 23 of
248 screened peptides were identified as candidates for antimicrobial effects. After commercial
synthesis, their antimicrobial activities were determined against Escherichia coli NEB5 alpha,
E. coli ATCC25922, and Bacillus subtilis ATCC6051. In the tested concentration range (<2
mM), bacteriostatic activity of 14 peptides was detected including nine peptides inhibiting both
Gram-positive and Gram-negative bacteria. The most effective fragment was TKLTEEEKNRLNFLKKISQRYQKFALPQYLK corresponding to alpha(S2)-casein151–181, with minimum inhibitory concentration (MIC) of 4.0 muM against B. subtilis ATCC6051, and minimum inhibitory concentrations of 16.2 M against both E. coli strains. Circular dichroism spectroscopy revealed conformational changes of most active peptides in a membrane-mimic environment, transitioning from an unordered to alpha-helical structure.
Conclusion: Screening of food peptide databases by prediction tools is an efficient method
to identify novel antimicrobial food-derived peptides. Milk-derived antimicrobial peptides may
have potential use as functional food ingredients and help to understand the molecular mechanisms of anti-infective milk effects.},
author = {Liu, Yufang and Eichler, Jutta and Pischetsrieder, Monika},
doi = {10.1002/mnfr.201500182},
faupublication = {yes},
journal = {Molecular Nutrition & Food Research},
keywords = {antimicrobial peptide; circular dichroism; milk; Peptide database; virtual screening},
pages = {2243-2254},
peerreviewed = {Yes},
title = {{Virtual} screening of a milk peptide database for the identification of food-derived antimicrobial peptides},
volume = {59},
year = {2015}
}